BLASTX nr result
ID: Lithospermum23_contig00001297
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00001297 (941 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019258359.1 PREDICTED: ferredoxin-thioredoxin reductase, vari... 135 9e-36 XP_009630916.1 PREDICTED: ferredoxin-thioredoxin reductase, vari... 134 4e-35 XP_015063054.1 PREDICTED: ferredoxin-thioredoxin reductase, vari... 132 3e-34 CDP07798.1 unnamed protein product [Coffea canephora] 132 4e-34 XP_016484174.1 PREDICTED: ferredoxin-thioredoxin reductase, vari... 131 6e-34 XP_009776324.1 PREDICTED: ferredoxin-thioredoxin reductase, vari... 131 6e-34 XP_006345426.1 PREDICTED: ferredoxin-thioredoxin reductase, vari... 130 1e-33 KZN05515.1 hypothetical protein DCAR_006352 [Daucus carota subsp... 129 3e-33 XP_017232469.1 PREDICTED: ferredoxin-thioredoxin reductase, vari... 129 6e-33 XP_004229646.1 PREDICTED: ferredoxin-thioredoxin reductase, vari... 127 1e-32 CAC39619.1 subunit A of ferredoxin-thioredoxin-reductase [Solanu... 127 1e-32 XP_011087933.1 PREDICTED: ferredoxin-thioredoxin reductase, vari... 127 3e-32 XP_019186424.1 PREDICTED: ferredoxin-thioredoxin reductase, vari... 126 5e-32 XP_012847365.1 PREDICTED: ferredoxin-thioredoxin reductase, vari... 124 4e-31 XP_010105193.1 Ferredoxin-thioredoxin reductase, variable chain ... 124 4e-31 XP_016538434.1 PREDICTED: ferredoxin-thioredoxin reductase, vari... 122 8e-31 KZV23724.1 ferredoxin-thioredoxin reductase, variable chain-like... 121 4e-30 XP_010276155.1 PREDICTED: ferredoxin-thioredoxin reductase, vari... 121 5e-30 NP_001295702.1 ferredoxin-thioredoxin reductase, variable chain,... 122 6e-30 AFK46976.1 unknown [Lotus japonicus] 120 8e-30 >XP_019258359.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Nicotiana attenuata] OIT40574.1 ferredoxin-thioredoxin reductase, variable chain [Nicotiana attenuata] Length = 164 Score = 135 bits (341), Expect = 9e-36 Identities = 78/166 (46%), Positives = 101/166 (60%), Gaps = 16/166 (9%) Frame = +1 Query: 277 STLLNLHSSKSKTICLFSQNPF-------STTSLKTTPFFIXXXXXXXXXXXXXXVDKPI 435 S++LN+ ++K+ + L + NPF S KT +FI VD P Sbjct: 11 SSILNILNAKTPSFIL-NPNPFPQIKVKKSRNPKKTNGYFISRSVT---------VDNPT 60 Query: 436 XXXXXXXXXXDE---------LGGARIGAKIRVKVPLKVYHIPKVPEFDLDGKIGTMKQF 588 DE +G ++G+++RV VPLKVYH+PKVPE DL +IGT+KQ+ Sbjct: 61 TVSSSSALNLDEGVDEKSAEAIG--KVGSRVRVTVPLKVYHVPKVPELDLVNRIGTLKQY 118 Query: 589 VGFHKGKTISANLPFKVEFKEDGIEGRDGPVKFFAHLKEDEFEYVD 726 VGFHKGK ISANLP+KVEF D +EGRDGPVKF AHLKEDEFE++D Sbjct: 119 VGFHKGKQISANLPYKVEFVVDNLEGRDGPVKFLAHLKEDEFEFLD 164 >XP_009630916.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Nicotiana tomentosiformis] XP_016508304.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Nicotiana tabacum] Length = 164 Score = 134 bits (337), Expect = 4e-35 Identities = 59/81 (72%), Positives = 72/81 (88%) Frame = +1 Query: 484 RIGAKIRVKVPLKVYHIPKVPEFDLDGKIGTMKQFVGFHKGKTISANLPFKVEFKEDGIE 663 ++G+++RV VPLKVYH+PKVPE DL +IGT+KQ+VGFHKGK ISANLP+KVEF D +E Sbjct: 84 KVGSRVRVTVPLKVYHVPKVPELDLVNRIGTLKQYVGFHKGKQISANLPYKVEFVVDNLE 143 Query: 664 GRDGPVKFFAHLKEDEFEYVD 726 GRDGPVKF AHLKEDEFE++D Sbjct: 144 GRDGPVKFLAHLKEDEFEFLD 164 >XP_015063054.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Solanum pennellii] Length = 171 Score = 132 bits (331), Expect = 3e-34 Identities = 75/163 (46%), Positives = 96/163 (58%), Gaps = 13/163 (7%) Frame = +1 Query: 277 STLLNLHSSKSKTICLFSQ------NPF-------STTSLKTTPFFIXXXXXXXXXXXXX 417 S++LN+ +SK+K++ + S NPF S S K +FI Sbjct: 11 SSVLNIPNSKNKSLIIPSHKNIINPNPFPQIKIHKSRNSQKPNGYFISKSVIVDNPSTVS 70 Query: 418 XVDKPIXXXXXXXXXXDELGGARIGAKIRVKVPLKVYHIPKVPEFDLDGKIGTMKQFVGF 597 K D ++G+K+RV VPLKVYH+PKVPE DLDG+IGT+KQ+V Sbjct: 71 --SKSSLSVDAGVDEKDAAAMGKVGSKVRVTVPLKVYHVPKVPELDLDGRIGTVKQYVAV 128 Query: 598 HKGKTISANLPFKVEFKEDGIEGRDGPVKFFAHLKEDEFEYVD 726 HKGK ISANLP+KVEF D +EGR PVKF AHLKEDEFE++D Sbjct: 129 HKGKQISANLPYKVEFVVDDLEGRSTPVKFSAHLKEDEFEFLD 171 >CDP07798.1 unnamed protein product [Coffea canephora] Length = 178 Score = 132 bits (331), Expect = 4e-34 Identities = 58/81 (71%), Positives = 72/81 (88%) Frame = +1 Query: 484 RIGAKIRVKVPLKVYHIPKVPEFDLDGKIGTMKQFVGFHKGKTISANLPFKVEFKEDGIE 663 + GA++RVKVP+KVYH+PKVPE DL+G+IG +KQ+V HKGK ISANLP+KVEF E+ +E Sbjct: 98 KFGARVRVKVPIKVYHVPKVPETDLNGRIGFLKQYVAVHKGKKISANLPYKVEFVEEHVE 157 Query: 664 GRDGPVKFFAHLKEDEFEYVD 726 G+ GPVKFFAHLKEDEFEY+D Sbjct: 158 GKKGPVKFFAHLKEDEFEYLD 178 >XP_016484174.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Nicotiana tabacum] Length = 164 Score = 131 bits (329), Expect = 6e-34 Identities = 77/166 (46%), Positives = 99/166 (59%), Gaps = 16/166 (9%) Frame = +1 Query: 277 STLLNLHSSKSKTICLFSQNPF-------STTSLKTTPFFIXXXXXXXXXXXXXXVDKPI 435 S++LN+ +SK+ + L + NPF S K T +FI VD P Sbjct: 11 SSILNIPNSKTSSFIL-NPNPFPQIKVNKSRNPKKPTGYFISKSVT---------VDNPT 60 Query: 436 XXXXXXXXXXDE---------LGGARIGAKIRVKVPLKVYHIPKVPEFDLDGKIGTMKQF 588 DE +G ++G+++RV VPLKVYH+PKVPE DL +IGT+KQ+ Sbjct: 61 TVSSSSSLNLDEGVDEKSAEAIG--KVGSRVRVTVPLKVYHVPKVPELDLVNRIGTLKQY 118 Query: 589 VGFHKGKTISANLPFKVEFKEDGIEGRDGPVKFFAHLKEDEFEYVD 726 VGFHKGK ISANLP+KVEF +EGRDG VKF AHLKEDEFE++D Sbjct: 119 VGFHKGKQISANLPYKVEFVVANLEGRDGSVKFLAHLKEDEFEFLD 164 >XP_009776324.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Nicotiana sylvestris] Length = 164 Score = 131 bits (329), Expect = 6e-34 Identities = 77/166 (46%), Positives = 99/166 (59%), Gaps = 16/166 (9%) Frame = +1 Query: 277 STLLNLHSSKSKTICLFSQNPF-------STTSLKTTPFFIXXXXXXXXXXXXXXVDKPI 435 S++LN+ +SK+ + L + NPF S K T +FI VD P Sbjct: 11 SSILNIPNSKTSSFIL-NPNPFPQIKVNKSRNPKKPTGYFISKSVT---------VDNPT 60 Query: 436 XXXXXXXXXXDE---------LGGARIGAKIRVKVPLKVYHIPKVPEFDLDGKIGTMKQF 588 DE +G ++G+++RV VPLKVYH+PKVPE DL +IGT+KQ+ Sbjct: 61 TVSSSSALNLDEGVDEKSAEAIG--KVGSRVRVTVPLKVYHVPKVPELDLVNRIGTLKQY 118 Query: 589 VGFHKGKTISANLPFKVEFKEDGIEGRDGPVKFFAHLKEDEFEYVD 726 VGFHKGK ISANLP+KVEF +EGRDG VKF AHLKEDEFE++D Sbjct: 119 VGFHKGKQISANLPYKVEFVVANLEGRDGSVKFLAHLKEDEFEFLD 164 >XP_006345426.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Solanum tuberosum] Length = 171 Score = 130 bits (328), Expect = 1e-33 Identities = 73/161 (45%), Positives = 95/161 (59%), Gaps = 11/161 (6%) Frame = +1 Query: 277 STLLNLHSSKSKTICLFSQ----NPFSTTSLKTTPFFIXXXXXXXXXXXXXXVDKPIXXX 444 S++LN+ +SK++++ + S NP T +K VD P Sbjct: 11 SSVLNIPNSKNQSLIIPSHKNILNPNPFTQIKIHKTRNPQKPNGYFISKSVTVDNPSTVS 70 Query: 445 XXXXXXXDE-------LGGARIGAKIRVKVPLKVYHIPKVPEFDLDGKIGTMKQFVGFHK 603 DE ++G+K+RV VPLKVYH+PKVPE DLDG+IGT+KQ+V HK Sbjct: 71 STSSLSVDEGVDEKDAAAMGKVGSKVRVTVPLKVYHVPKVPELDLDGRIGTVKQYVAVHK 130 Query: 604 GKTISANLPFKVEFKEDGIEGRDGPVKFFAHLKEDEFEYVD 726 GK ISANLP+KVEF D +EGR PVKF AHLKEDEFE++D Sbjct: 131 GKQISANLPYKVEFVVDDLEGRSTPVKFSAHLKEDEFEFLD 171 >KZN05515.1 hypothetical protein DCAR_006352 [Daucus carota subsp. sativus] Length = 173 Score = 129 bits (325), Expect = 3e-33 Identities = 60/81 (74%), Positives = 71/81 (87%) Frame = +1 Query: 484 RIGAKIRVKVPLKVYHIPKVPEFDLDGKIGTMKQFVGFHKGKTISANLPFKVEFKEDGIE 663 ++GA+++VKVPLKVYH+PKV EFDL+G G +KQFVG KGK ISANLPFKV+F + IE Sbjct: 93 KVGARVKVKVPLKVYHVPKVSEFDLNGLEGEIKQFVGVWKGKRISANLPFKVQFVVEKIE 152 Query: 664 GRDGPVKFFAHLKEDEFEYVD 726 GRDGPVKFFAHLKEDEFEY+D Sbjct: 153 GRDGPVKFFAHLKEDEFEYLD 173 >XP_017232469.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain, chloroplastic-like [Daucus carota subsp. sativus] Length = 197 Score = 129 bits (325), Expect = 6e-33 Identities = 60/81 (74%), Positives = 71/81 (87%) Frame = +1 Query: 484 RIGAKIRVKVPLKVYHIPKVPEFDLDGKIGTMKQFVGFHKGKTISANLPFKVEFKEDGIE 663 ++GA+++VKVPLKVYH+PKV EFDL+G G +KQFVG KGK ISANLPFKV+F + IE Sbjct: 117 KVGARVKVKVPLKVYHVPKVSEFDLNGLEGEIKQFVGVWKGKRISANLPFKVQFVVEKIE 176 Query: 664 GRDGPVKFFAHLKEDEFEYVD 726 GRDGPVKFFAHLKEDEFEY+D Sbjct: 177 GRDGPVKFFAHLKEDEFEYLD 197 >XP_004229646.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Solanum lycopersicum] Length = 171 Score = 127 bits (320), Expect = 1e-32 Identities = 58/87 (66%), Positives = 70/87 (80%) Frame = +1 Query: 466 DELGGARIGAKIRVKVPLKVYHIPKVPEFDLDGKIGTMKQFVGFHKGKTISANLPFKVEF 645 D ++G+K+RV VPLKVYH+PKVPE DLDG+ GT+KQ+V HKGK ISANLP+KVEF Sbjct: 85 DAAAMGKVGSKVRVTVPLKVYHVPKVPELDLDGRTGTVKQYVAVHKGKQISANLPYKVEF 144 Query: 646 KEDGIEGRDGPVKFFAHLKEDEFEYVD 726 D +EGR PVKF AHLKEDEFE++D Sbjct: 145 VVDDLEGRSTPVKFSAHLKEDEFEFLD 171 >CAC39619.1 subunit A of ferredoxin-thioredoxin-reductase [Solanum tuberosum] Length = 171 Score = 127 bits (320), Expect = 1e-32 Identities = 72/161 (44%), Positives = 94/161 (58%), Gaps = 11/161 (6%) Frame = +1 Query: 277 STLLNLHSSKSKTICLFSQ----NPFSTTSLKTTPFFIXXXXXXXXXXXXXXVDKPIXXX 444 S++LN+ +SK++++ + S NP T +K VD P Sbjct: 11 SSILNIPNSKNQSLIIPSHKNILNPNPFTQIKIHKSRNPQKPNGYFISKSVTVDNPSTVS 70 Query: 445 XXXXXXXDE-------LGGARIGAKIRVKVPLKVYHIPKVPEFDLDGKIGTMKQFVGFHK 603 DE ++G+K+RV VPLKVYH PKVPE DLDG+IGT+KQ+V HK Sbjct: 71 STSSLSVDEGVDEKDAAAMGKVGSKVRVTVPLKVYHEPKVPELDLDGRIGTVKQYVAVHK 130 Query: 604 GKTISANLPFKVEFKEDGIEGRDGPVKFFAHLKEDEFEYVD 726 GK ISANLP+KV+F D +EGR PVKF AHLKEDEFE++D Sbjct: 131 GKQISANLPYKVQFVVDDLEGRSTPVKFSAHLKEDEFEFLD 171 >XP_011087933.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Sesamum indicum] Length = 168 Score = 127 bits (318), Expect = 3e-32 Identities = 59/83 (71%), Positives = 72/83 (86%), Gaps = 1/83 (1%) Frame = +1 Query: 481 ARIGAKIRVKVPLKVYHIPKVPEFDLDGKIGTMKQFVGFHKGKTISANLPFKVEFKEDGI 660 +RIGA++RVK P+KVYH+PKVPEF+L GKIG +KQ+VG HKGK ISANLP+KVEF D + Sbjct: 86 SRIGARVRVKEPVKVYHVPKVPEFELTGKIGVLKQYVGVHKGKKISANLPYKVEFVADEV 145 Query: 661 EGRDG-PVKFFAHLKEDEFEYVD 726 GRDG PVKF AHL+EDEFE++D Sbjct: 146 LGRDGNPVKFTAHLREDEFEFLD 168 >XP_019186424.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Ipomoea nil] Length = 163 Score = 126 bits (316), Expect = 5e-32 Identities = 55/82 (67%), Positives = 69/82 (84%) Frame = +1 Query: 481 ARIGAKIRVKVPLKVYHIPKVPEFDLDGKIGTMKQFVGFHKGKTISANLPFKVEFKEDGI 660 A+IG+K+RV PLKVYH+PKVPEFDL G+ G +KQ+ HKGK ISANLP+KVEF +G+ Sbjct: 82 AKIGSKVRVTAPLKVYHVPKVPEFDLTGRTGVLKQYAALHKGKPISANLPYKVEFVVEGM 141 Query: 661 EGRDGPVKFFAHLKEDEFEYVD 726 EGR GP+KF AHL+EDEFE++D Sbjct: 142 EGRKGPLKFVAHLREDEFEFLD 163 >XP_012847365.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Erythranthe guttata] EYU29040.1 hypothetical protein MIMGU_mgv1a015025mg [Erythranthe guttata] Length = 170 Score = 124 bits (310), Expect = 4e-31 Identities = 56/83 (67%), Positives = 70/83 (84%), Gaps = 1/83 (1%) Frame = +1 Query: 481 ARIGAKIRVKVPLKVYHIPKVPEFDLDGKIGTMKQFVGFHKGKTISANLPFKVEFKEDGI 660 +++GAK+RVK PL VYHIPK+PE DL GK+G +KQ+VG HKGK ISANLP+K+EF D + Sbjct: 88 SKLGAKVRVKAPLVVYHIPKLPELDLTGKVGVLKQYVGVHKGKKISANLPYKIEFVADDL 147 Query: 661 EGRDG-PVKFFAHLKEDEFEYVD 726 GRDG PVKF AHL+EDEFE++D Sbjct: 148 PGRDGKPVKFSAHLREDEFEFLD 170 >XP_010105193.1 Ferredoxin-thioredoxin reductase, variable chain [Morus notabilis] EXC04047.1 Ferredoxin-thioredoxin reductase, variable chain [Morus notabilis] Length = 171 Score = 124 bits (310), Expect = 4e-31 Identities = 62/86 (72%), Positives = 72/86 (83%) Frame = +1 Query: 466 DELGGARIGAKIRVKVPLKVYHIPKVPEFDLDGKIGTMKQFVGFHKGKTISANLPFKVEF 645 DE GGARIGA++RVKVPLKVYH+PKVPE D+ G G +KQ+VG KGK ISANLP+KV+F Sbjct: 88 DETGGARIGARVRVKVPLKVYHVPKVPEIDILGMEGELKQYVGVWKGKRISANLPYKVQF 147 Query: 646 KEDGIEGRDGPVKFFAHLKEDEFEYV 723 + +EGR G VKFFAHLKEDEFEYV Sbjct: 148 LTE-VEGR-GKVKFFAHLKEDEFEYV 171 >XP_016538434.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Capsicum annuum] Length = 154 Score = 122 bits (307), Expect = 8e-31 Identities = 53/81 (65%), Positives = 69/81 (85%) Frame = +1 Query: 484 RIGAKIRVKVPLKVYHIPKVPEFDLDGKIGTMKQFVGFHKGKTISANLPFKVEFKEDGIE 663 ++G+K+RV VP+KVYH+PKVPE DL+G+IGT+KQ+V +KGK ISAN P+KVEF D +E Sbjct: 74 KVGSKVRVTVPVKVYHVPKVPELDLNGRIGTLKQYVAIYKGKQISANFPYKVEFVVDNLE 133 Query: 664 GRDGPVKFFAHLKEDEFEYVD 726 GR PVKF AHLKEDEFE+++ Sbjct: 134 GRSAPVKFAAHLKEDEFEFLE 154 >KZV23724.1 ferredoxin-thioredoxin reductase, variable chain-like [Dorcoceras hygrometricum] Length = 167 Score = 121 bits (303), Expect = 4e-30 Identities = 54/83 (65%), Positives = 71/83 (85%), Gaps = 1/83 (1%) Frame = +1 Query: 481 ARIGAKIRVKVPLKVYHIPKVPEFDLDGKIGTMKQFVGFHKGKTISANLPFKVEFKEDGI 660 +++G+K+RV VPL VYH+PK+PEF+L G +G +KQ+VGFHKGK ISANLP+KVEF+ D + Sbjct: 85 SKLGSKVRVSVPLTVYHVPKLPEFELTGMVGVLKQYVGFHKGKRISANLPYKVEFETDKV 144 Query: 661 EGRDG-PVKFFAHLKEDEFEYVD 726 GRDG PVKF AHL+EDEFE ++ Sbjct: 145 LGRDGKPVKFTAHLREDEFEILE 167 >XP_010276155.1 PREDICTED: ferredoxin-thioredoxin reductase, variable chain-like [Nelumbo nucifera] Length = 182 Score = 121 bits (304), Expect = 5e-30 Identities = 64/87 (73%), Positives = 70/87 (80%) Frame = +1 Query: 466 DELGGARIGAKIRVKVPLKVYHIPKVPEFDLDGKIGTMKQFVGFHKGKTISANLPFKVEF 645 +E A+IGA++RVKVPLKVYHIPKVPEFDL G G +KQ+VG KG ISANLPFKVEF Sbjct: 94 EESSLAKIGARVRVKVPLKVYHIPKVPEFDLTGMEGELKQYVGLWKGNRISANLPFKVEF 153 Query: 646 KEDGIEGRDGPVKFFAHLKEDEFEYVD 726 IEGR G VKFFAHLKEDEFEYVD Sbjct: 154 VTK-IEGR-GTVKFFAHLKEDEFEYVD 178 >NP_001295702.1 ferredoxin-thioredoxin reductase, variable chain, chloroplastic [Jatropha curcas] AEY80143.1 lipoic acid synthase [Jatropha curcas] KDP40455.1 hypothetical protein JCGZ_24454 [Jatropha curcas] Length = 201 Score = 122 bits (305), Expect = 6e-30 Identities = 61/87 (70%), Positives = 71/87 (81%) Frame = +1 Query: 466 DELGGARIGAKIRVKVPLKVYHIPKVPEFDLDGKIGTMKQFVGFHKGKTISANLPFKVEF 645 +E +IGA++RVKVPLKVYH+P+VPE DL GK G +KQ+V KGK ISANLP+KVEF Sbjct: 117 EEQAEKKIGARVRVKVPLKVYHVPRVPEVDLTGKEGNLKQYVALWKGKRISANLPYKVEF 176 Query: 646 KEDGIEGRDGPVKFFAHLKEDEFEYVD 726 D IEGR GPVKFFAHLKEDEFEY+D Sbjct: 177 TMD-IEGR-GPVKFFAHLKEDEFEYLD 201 >AFK46976.1 unknown [Lotus japonicus] Length = 166 Score = 120 bits (301), Expect = 8e-30 Identities = 68/152 (44%), Positives = 92/152 (60%), Gaps = 1/152 (0%) Frame = +1 Query: 271 PPSTLLNLHSSKSKTICLFSQNPFSTTSLKTTPFFIXXXXXXXXXXXXXX-VDKPIXXXX 447 P S LL++ ++S + L PFS++S P F V++ Sbjct: 17 PSSPLLSVSPNRSSMLLLTKSIPFSSSSSIHPPLFANLRGSSRSITRCEVAVEESSPSST 76 Query: 448 XXXXXXDELGGARIGAKIRVKVPLKVYHIPKVPEFDLDGKIGTMKQFVGFHKGKTISANL 627 +E +++GA++RVKVPLKVYH+PKVPEFDL+G G +KQ+V KGK ISAN Sbjct: 77 SSSSESEEAESSKVGARVRVKVPLKVYHVPKVPEFDLEGAEGEIKQYVALWKGKKISANF 136 Query: 628 PFKVEFKEDGIEGRDGPVKFFAHLKEDEFEYV 723 P+KV+F + IEGR G VKFFAHLKEDEFE++ Sbjct: 137 PYKVQFVTE-IEGR-GAVKFFAHLKEDEFEFL 166