BLASTX nr result
ID: Lithospermum23_contig00000867
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00000867 (2744 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EOY18623.1 Uncharacterized protein TCM_043123 [Theobroma cacao] 58 8e-07 >EOY18623.1 Uncharacterized protein TCM_043123 [Theobroma cacao] Length = 97 Score = 58.2 bits (139), Expect = 8e-07 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = -2 Query: 2356 VYIRICLAPCMPFAELSIDHRWPPWMAYEEPSIFTHRIY 2240 + + +CLAPCMPFAE + +HRW PWMAYEEP I++ IY Sbjct: 22 IRVYMCLAPCMPFAEPT-EHRWSPWMAYEEPCIYSMYIY 59