BLASTX nr result
ID: Lithospermum23_contig00000422
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00000422 (1205 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AHY23248.1 putative ubiquitin-conjugating enzyme [Fallopia multi... 100 6e-22 KRG98119.1 hypothetical protein GLYMA_18G051400 [Glycine max] 100 6e-22 KRG98120.1 hypothetical protein GLYMA_18G051400 [Glycine max] 99 8e-22 ABQ41977.1 ubiquitin-conjugating enzyme, partial [Sonneratia alba] 99 1e-21 XP_020082022.1 ubiquitin-conjugating enzyme E2-17 kDa-like [Anan... 97 1e-21 ABQ41978.1 ubiquitin-conjugating enzyme, partial [Sonneratia cas... 99 2e-21 XP_009604250.1 PREDICTED: ubiquitin-conjugating enzyme E2 28-lik... 97 3e-21 XP_020099309.1 ubiquitin-conjugating enzyme E2 10-like [Ananas c... 99 3e-21 KRG98118.1 hypothetical protein GLYMA_18G051400 [Glycine max] 99 3e-21 XP_011654707.1 PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa... 99 3e-21 XP_003538338.1 PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa... 99 3e-21 NP_001234969.1 uncharacterized protein LOC100527105 [Glycine max... 99 3e-21 GAV91332.1 UQ_con domain-containing protein [Cephalotus follicul... 99 4e-21 XP_019149661.1 PREDICTED: ubiquitin-conjugating enzyme E2 28-lik... 99 4e-21 XP_009788990.1 PREDICTED: ubiquitin-conjugating enzyme E2 28-lik... 99 4e-21 XP_009410860.1 PREDICTED: ubiquitin-conjugating enzyme E2 28 [Mu... 99 4e-21 XP_012083263.1 PREDICTED: ubiquitin-conjugating enzyme E2 28-lik... 99 4e-21 XP_012858690.1 PREDICTED: SUMO-conjugating enzyme UBC9 [Erythran... 99 4e-21 XP_004498394.1 PREDICTED: SUMO-conjugating enzyme UBC9-like [Cic... 99 4e-21 XP_006444893.1 hypothetical protein CICLE_v10022714mg [Citrus cl... 97 5e-21 >AHY23248.1 putative ubiquitin-conjugating enzyme [Fallopia multiflora] Length = 148 Score = 100 bits (250), Expect = 6e-22 Identities = 43/43 (100%), Positives = 43/43 (100%) Frame = -1 Query: 1205 PVAEDMFHWQATIMGPPDSPYTGGVFLVNIHFPPDYPFKPPKV 1077 PVAEDMFHWQATIMGPPDSPYTGGVFLVNIHFPPDYPFKPPKV Sbjct: 25 PVAEDMFHWQATIMGPPDSPYTGGVFLVNIHFPPDYPFKPPKV 67 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 85 KVAFKTKVFHPNINSNGSICLDILKEQW 2 KVAF+TKVFHPNINSNGSICLDILKEQW Sbjct: 66 KVAFRTKVFHPNINSNGSICLDILKEQW 93 >KRG98119.1 hypothetical protein GLYMA_18G051400 [Glycine max] Length = 113 Score = 99.8 bits (247), Expect = 6e-22 Identities = 43/45 (95%), Positives = 44/45 (97%) Frame = -1 Query: 1205 PVAEDMFHWQATIMGPPDSPYTGGVFLVNIHFPPDYPFKPPKVQL 1071 PVAEDMFHWQATIMGPPDSPYTGGVFLV+IHFPPDYPFKPPKV L Sbjct: 25 PVAEDMFHWQATIMGPPDSPYTGGVFLVSIHFPPDYPFKPPKVLL 69 >KRG98120.1 hypothetical protein GLYMA_18G051400 [Glycine max] Length = 102 Score = 99.0 bits (245), Expect = 8e-22 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 1205 PVAEDMFHWQATIMGPPDSPYTGGVFLVNIHFPPDYPFKPPKV 1077 PVAEDMFHWQATIMGPPDSPYTGGVFLV+IHFPPDYPFKPPKV Sbjct: 25 PVAEDMFHWQATIMGPPDSPYTGGVFLVSIHFPPDYPFKPPKV 67 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 85 KVAFKTKVFHPNINSNGSICLDILKEQW 2 KVAF+TKVFHPNINSNGSICLDILKEQW Sbjct: 66 KVAFRTKVFHPNINSNGSICLDILKEQW 93 >ABQ41977.1 ubiquitin-conjugating enzyme, partial [Sonneratia alba] Length = 114 Score = 99.0 bits (245), Expect = 1e-21 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 1205 PVAEDMFHWQATIMGPPDSPYTGGVFLVNIHFPPDYPFKPPKV 1077 PVAEDMFHWQATIMGPPDSPYTGGVFLV+IHFPPDYPFKPPKV Sbjct: 1 PVAEDMFHWQATIMGPPDSPYTGGVFLVSIHFPPDYPFKPPKV 43 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 85 KVAFKTKVFHPNINSNGSICLDILKEQW 2 KVAF+TKVFHPNINSNGSICLDILKEQW Sbjct: 42 KVAFRTKVFHPNINSNGSICLDILKEQW 69 >XP_020082022.1 ubiquitin-conjugating enzyme E2-17 kDa-like [Ananas comosus] Length = 68 Score = 97.4 bits (241), Expect = 1e-21 Identities = 41/43 (95%), Positives = 41/43 (95%) Frame = -1 Query: 1205 PVAEDMFHWQATIMGPPDSPYTGGVFLVNIHFPPDYPFKPPKV 1077 P AEDMFHWQATIMGPPDSPY GGVFLVNIHFPPDYPFKPPKV Sbjct: 25 PAAEDMFHWQATIMGPPDSPYAGGVFLVNIHFPPDYPFKPPKV 67 >ABQ41978.1 ubiquitin-conjugating enzyme, partial [Sonneratia caseolaris] ABQ41979.1 ubiquitin-conjugating enzyme, partial [Sonneratia ovata] ABQ41980.1 ubiquitin-conjugating enzyme, partial [Sonneratia apetala] Length = 114 Score = 98.6 bits (244), Expect = 2e-21 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = -1 Query: 1205 PVAEDMFHWQATIMGPPDSPYTGGVFLVNIHFPPDYPFKPPKV 1077 PVAEDMFHWQATIMGPPDSPYTGGVFLV IHFPPDYPFKPPKV Sbjct: 1 PVAEDMFHWQATIMGPPDSPYTGGVFLVTIHFPPDYPFKPPKV 43 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 85 KVAFKTKVFHPNINSNGSICLDILKEQW 2 KVAF+TKVFHPNINSNGSICLDILKEQW Sbjct: 42 KVAFRTKVFHPNINSNGSICLDILKEQW 69 >XP_009604250.1 PREDICTED: ubiquitin-conjugating enzyme E2 28-like [Nicotiana tomentosiformis] XP_016510957.1 PREDICTED: ubiquitin-conjugating enzyme E2 28-like [Nicotiana tabacum] Length = 78 Score = 96.7 bits (239), Expect = 3e-21 Identities = 41/43 (95%), Positives = 41/43 (95%) Frame = -1 Query: 1205 PVAEDMFHWQATIMGPPDSPYTGGVFLVNIHFPPDYPFKPPKV 1077 PVAEDMFHWQATIMGPPDSPY GGVFLV IHFPPDYPFKPPKV Sbjct: 25 PVAEDMFHWQATIMGPPDSPYAGGVFLVTIHFPPDYPFKPPKV 67 >XP_020099309.1 ubiquitin-conjugating enzyme E2 10-like [Ananas comosus] OAY85585.1 Ubiquitin-conjugating enzyme E2 10 [Ananas comosus] Length = 148 Score = 99.0 bits (245), Expect = 3e-21 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = -1 Query: 1205 PVAEDMFHWQATIMGPPDSPYTGGVFLVNIHFPPDYPFKPPKV 1077 PVAEDMFHWQATIMGPPDSPY GGVFLVNIHFPPDYPFKPPKV Sbjct: 25 PVAEDMFHWQATIMGPPDSPYAGGVFLVNIHFPPDYPFKPPKV 67 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 85 KVAFKTKVFHPNINSNGSICLDILKEQW 2 KVAF+TKVFHPNINSNGSICLDILKEQW Sbjct: 66 KVAFRTKVFHPNINSNGSICLDILKEQW 93 >KRG98118.1 hypothetical protein GLYMA_18G051400 [Glycine max] Length = 148 Score = 99.0 bits (245), Expect = 3e-21 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 1205 PVAEDMFHWQATIMGPPDSPYTGGVFLVNIHFPPDYPFKPPKV 1077 PVAEDMFHWQATIMGPPDSPYTGGVFLV+IHFPPDYPFKPPKV Sbjct: 25 PVAEDMFHWQATIMGPPDSPYTGGVFLVSIHFPPDYPFKPPKV 67 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 85 KVAFKTKVFHPNINSNGSICLDILKEQW 2 KVAF+TKVFHPNINSNGSICLDILKEQW Sbjct: 66 KVAFRTKVFHPNINSNGSICLDILKEQW 93 >XP_011654707.1 PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa [Cucumis sativus] XP_016898870.1 PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa [Cucumis melo] KGN50038.1 Ubiquitin carrier protein [Cucumis sativus] Length = 148 Score = 99.0 bits (245), Expect = 3e-21 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = -1 Query: 1205 PVAEDMFHWQATIMGPPDSPYTGGVFLVNIHFPPDYPFKPPKV 1077 PVAEDMFHWQATIMGPPDSPY GGVFLVNIHFPPDYPFKPPKV Sbjct: 25 PVAEDMFHWQATIMGPPDSPYAGGVFLVNIHFPPDYPFKPPKV 67 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 85 KVAFKTKVFHPNINSNGSICLDILKEQW 2 KVAF+TKVFHPNINSNGSICLDILKEQW Sbjct: 66 KVAFRTKVFHPNINSNGSICLDILKEQW 93 >XP_003538338.1 PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa [Glycine max] KRH30665.1 hypothetical protein GLYMA_11G199400 [Glycine max] Length = 148 Score = 99.0 bits (245), Expect = 3e-21 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 1205 PVAEDMFHWQATIMGPPDSPYTGGVFLVNIHFPPDYPFKPPKV 1077 PVAEDMFHWQATIMGPPDSPYTGGVFLV+IHFPPDYPFKPPKV Sbjct: 25 PVAEDMFHWQATIMGPPDSPYTGGVFLVSIHFPPDYPFKPPKV 67 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 85 KVAFKTKVFHPNINSNGSICLDILKEQW 2 KVAF+TKVFHPNINSNGSICLDILKEQW Sbjct: 66 KVAFRTKVFHPNINSNGSICLDILKEQW 93 >NP_001234969.1 uncharacterized protein LOC100527105 [Glycine max] ACU16149.1 unknown [Glycine max] Length = 148 Score = 99.0 bits (245), Expect = 3e-21 Identities = 42/43 (97%), Positives = 43/43 (100%) Frame = -1 Query: 1205 PVAEDMFHWQATIMGPPDSPYTGGVFLVNIHFPPDYPFKPPKV 1077 PVAEDMFHWQATIMGPPDSPYTGGVFLV+IHFPPDYPFKPPKV Sbjct: 25 PVAEDMFHWQATIMGPPDSPYTGGVFLVSIHFPPDYPFKPPKV 67 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 85 KVAFKTKVFHPNINSNGSICLDILKEQW 2 KVAF+TKVFHPNINSNGSICLDILKEQW Sbjct: 66 KVAFRTKVFHPNINSNGSICLDILKEQW 93 >GAV91332.1 UQ_con domain-containing protein [Cephalotus follicularis] Length = 148 Score = 98.6 bits (244), Expect = 4e-21 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = -1 Query: 1205 PVAEDMFHWQATIMGPPDSPYTGGVFLVNIHFPPDYPFKPPKV 1077 PVAEDMFHWQATIMGPPDSPYTGGVFLV IHFPPDYPFKPPKV Sbjct: 25 PVAEDMFHWQATIMGPPDSPYTGGVFLVTIHFPPDYPFKPPKV 67 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 85 KVAFKTKVFHPNINSNGSICLDILKEQW 2 KVAF+TKVFHPNINSNGSICLDILKEQW Sbjct: 66 KVAFRTKVFHPNINSNGSICLDILKEQW 93 >XP_019149661.1 PREDICTED: ubiquitin-conjugating enzyme E2 28-like [Ipomoea nil] Length = 148 Score = 98.6 bits (244), Expect = 4e-21 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = -1 Query: 1205 PVAEDMFHWQATIMGPPDSPYTGGVFLVNIHFPPDYPFKPPKV 1077 PVAEDMFHWQATIMGPPDSPYTGGVFLV IHFPPDYPFKPPKV Sbjct: 25 PVAEDMFHWQATIMGPPDSPYTGGVFLVTIHFPPDYPFKPPKV 67 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -2 Query: 85 KVAFKTKVFHPNINSNGSICLDILKEQW 2 KVAFKTKVFHPNINSNGSICLDILKEQW Sbjct: 66 KVAFKTKVFHPNINSNGSICLDILKEQW 93 >XP_009788990.1 PREDICTED: ubiquitin-conjugating enzyme E2 28-like [Nicotiana sylvestris] XP_016433522.1 PREDICTED: ubiquitin-conjugating enzyme E2 28-like [Nicotiana tabacum] Length = 148 Score = 98.6 bits (244), Expect = 4e-21 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = -1 Query: 1205 PVAEDMFHWQATIMGPPDSPYTGGVFLVNIHFPPDYPFKPPKV 1077 PVAEDMFHWQATIMGPPDSPYTGGVFLV IHFPPDYPFKPPKV Sbjct: 25 PVAEDMFHWQATIMGPPDSPYTGGVFLVTIHFPPDYPFKPPKV 67 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 85 KVAFKTKVFHPNINSNGSICLDILKEQW 2 KVAF+TKVFHPNINSNGSICLDILKEQW Sbjct: 66 KVAFRTKVFHPNINSNGSICLDILKEQW 93 >XP_009410860.1 PREDICTED: ubiquitin-conjugating enzyme E2 28 [Musa acuminata subsp. malaccensis] Length = 148 Score = 98.6 bits (244), Expect = 4e-21 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = -1 Query: 1205 PVAEDMFHWQATIMGPPDSPYTGGVFLVNIHFPPDYPFKPPKV 1077 PVAEDMFHWQATIMGPPDSPYTGGVFLV IHFPPDYPFKPPKV Sbjct: 25 PVAEDMFHWQATIMGPPDSPYTGGVFLVTIHFPPDYPFKPPKV 67 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 85 KVAFKTKVFHPNINSNGSICLDILKEQW 2 KVAF+TKVFHPNINSNGSICLDILKEQW Sbjct: 66 KVAFRTKVFHPNINSNGSICLDILKEQW 93 >XP_012083263.1 PREDICTED: ubiquitin-conjugating enzyme E2 28-like [Jatropha curcas] KDP28526.1 hypothetical protein JCGZ_14297 [Jatropha curcas] Length = 148 Score = 98.6 bits (244), Expect = 4e-21 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = -1 Query: 1205 PVAEDMFHWQATIMGPPDSPYTGGVFLVNIHFPPDYPFKPPKV 1077 PVAEDMFHWQATIMGPPDSPYTGGVFLV IHFPPDYPFKPPKV Sbjct: 25 PVAEDMFHWQATIMGPPDSPYTGGVFLVTIHFPPDYPFKPPKV 67 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 85 KVAFKTKVFHPNINSNGSICLDILKEQW 2 KVAF+TKVFHPNINSNGSICLDILKEQW Sbjct: 66 KVAFRTKVFHPNINSNGSICLDILKEQW 93 >XP_012858690.1 PREDICTED: SUMO-conjugating enzyme UBC9 [Erythranthe guttata] XP_015896401.1 PREDICTED: SUMO-conjugating enzyme UBC9 [Ziziphus jujuba] EYU19615.1 hypothetical protein MIMGU_mgv1a015722mg [Erythranthe guttata] Length = 148 Score = 98.6 bits (244), Expect = 4e-21 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = -1 Query: 1205 PVAEDMFHWQATIMGPPDSPYTGGVFLVNIHFPPDYPFKPPKV 1077 PVAEDMFHWQATIMGPPDSPYTGGVFLV IHFPPDYPFKPPKV Sbjct: 25 PVAEDMFHWQATIMGPPDSPYTGGVFLVTIHFPPDYPFKPPKV 67 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 85 KVAFKTKVFHPNINSNGSICLDILKEQW 2 KVAF+TKVFHPNINSNGSICLDILKEQW Sbjct: 66 KVAFRTKVFHPNINSNGSICLDILKEQW 93 >XP_004498394.1 PREDICTED: SUMO-conjugating enzyme UBC9-like [Cicer arietinum] XP_004498395.1 PREDICTED: SUMO-conjugating enzyme UBC9-like [Cicer arietinum] Length = 148 Score = 98.6 bits (244), Expect = 4e-21 Identities = 42/43 (97%), Positives = 42/43 (97%) Frame = -1 Query: 1205 PVAEDMFHWQATIMGPPDSPYTGGVFLVNIHFPPDYPFKPPKV 1077 PVAEDMFHWQATIMGPPDSPYTGGVFLV IHFPPDYPFKPPKV Sbjct: 25 PVAEDMFHWQATIMGPPDSPYTGGVFLVTIHFPPDYPFKPPKV 67 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 85 KVAFKTKVFHPNINSNGSICLDILKEQW 2 KVAF+TKVFHPNINSNGSICLDILKEQW Sbjct: 66 KVAFRTKVFHPNINSNGSICLDILKEQW 93 >XP_006444893.1 hypothetical protein CICLE_v10022714mg [Citrus clementina] ESR58133.1 hypothetical protein CICLE_v10022714mg [Citrus clementina] KDO86395.1 hypothetical protein CISIN_1g032055mg [Citrus sinensis] Length = 107 Score = 97.1 bits (240), Expect = 5e-21 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = -1 Query: 1205 PVAEDMFHWQATIMGPPDSPYTGGVFLVNIHFPPDYPFKPPKV 1077 PVAEDMFHWQATIMGPPDSPY GGVFLV+IHFPPDYPFKPPKV Sbjct: 25 PVAEDMFHWQATIMGPPDSPYAGGVFLVSIHFPPDYPFKPPKV 67 Score = 62.0 bits (149), Expect = 2e-08 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -2 Query: 85 KVAFKTKVFHPNINSNGSICLDILKEQW 2 KVAF+TKVFHPNINSNGSICLDILKEQW Sbjct: 66 KVAFRTKVFHPNINSNGSICLDILKEQW 93