BLASTX nr result
ID: Lithospermum23_contig00000371
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00000371 (682 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN42697.1 Protein transport protein Sec16B [Glycine soja] 72 2e-13 XP_015889175.1 PREDICTED: 40S ribosomal protein S30-like [Ziziph... 72 2e-13 XP_003608708.1 40S ribosomal S30-like protein [Medicago truncatu... 72 2e-13 KQL31981.1 hypothetical protein SETIT_019362mg, partial [Setaria... 72 2e-13 NP_001149323.1 uncharacterized protein LOC100282946 [Zea mays] X... 72 2e-13 XP_010086894.1 40S ribosomal protein S30 [Morus notabilis] EXB24... 72 2e-13 XP_010670553.1 PREDICTED: 40S ribosomal protein S30 [Beta vulgar... 72 2e-13 KGN60553.1 40S ribosomal protein S30-like [Cucumis sativus] 72 2e-13 XP_009766159.1 PREDICTED: 40S ribosomal protein S30-like [Nicoti... 72 2e-13 CDP14733.1 unnamed protein product [Coffea canephora] 72 2e-13 KDO55923.1 hypothetical protein CISIN_1g042287mg, partial [Citru... 72 2e-13 CBI35991.3 unnamed protein product, partial [Vitis vinifera] 72 2e-13 EYU41614.1 hypothetical protein MIMGU_mgv1a016770mg [Erythranthe... 72 2e-13 XP_006451370.1 hypothetical protein CICLE_v10009868mg [Citrus cl... 72 2e-13 OEL35698.1 40S ribosomal protein S30, partial [Dichanthelium oli... 72 3e-13 EPS69967.1 hypothetical protein M569_04801, partial [Genlisea au... 72 3e-13 OEL26885.1 40S ribosomal protein S30, partial [Dichanthelium oli... 72 3e-13 KOM44808.1 hypothetical protein LR48_Vigan06g011400, partial [Vi... 72 3e-13 XP_006858925.1 PREDICTED: 40S ribosomal protein S30 [Amborella t... 72 3e-13 KYP67165.1 40S ribosomal protein S30 [Cajanus cajan] 72 3e-13 >KHN42697.1 Protein transport protein Sec16B [Glycine soja] Length = 1489 Score = 72.0 bits (175), Expect(2) = 2e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 459 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 361 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK Sbjct: 1457 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 1489 Score = 31.6 bits (70), Expect(2) = 2e-13 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 544 MGKVHGSLARAGKV 503 MGKVHGSLARAGKV Sbjct: 1428 MGKVHGSLARAGKV 1441 >XP_015889175.1 PREDICTED: 40S ribosomal protein S30-like [Ziziphus jujuba] Length = 122 Score = 72.0 bits (175), Expect(2) = 2e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 459 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 361 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK Sbjct: 90 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 122 Score = 31.6 bits (70), Expect(2) = 2e-13 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 544 MGKVHGSLARAGKV 503 MGKVHGSLARAGKV Sbjct: 61 MGKVHGSLARAGKV 74 >XP_003608708.1 40S ribosomal S30-like protein [Medicago truncatula] XP_003611308.1 40S ribosomal S30-like protein [Medicago truncatula] AES90905.1 40S ribosomal S30-like protein [Medicago truncatula] AES94266.1 40S ribosomal S30-like protein [Medicago truncatula] Length = 62 Score = 72.0 bits (175), Expect(2) = 2e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 459 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 361 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK Sbjct: 30 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 62 Score = 31.6 bits (70), Expect(2) = 2e-13 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 544 MGKVHGSLARAGKV 503 MGKVHGSLARAGKV Sbjct: 1 MGKVHGSLARAGKV 14 >KQL31981.1 hypothetical protein SETIT_019362mg, partial [Setaria italica] Length = 93 Score = 72.0 bits (175), Expect(2) = 2e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 459 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 361 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK Sbjct: 61 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 93 Score = 31.6 bits (70), Expect(2) = 2e-13 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 544 MGKVHGSLARAGKV 503 MGKVHGSLARAGKV Sbjct: 32 MGKVHGSLARAGKV 45 >NP_001149323.1 uncharacterized protein LOC100282946 [Zea mays] XP_002318077.1 40S ribosomal protein S30 [Populus trichocarpa] XP_002322202.1 40S ribosomal protein S30 [Populus trichocarpa] XP_002281376.1 PREDICTED: 40S ribosomal protein S30 [Vitis vinifera] XP_002283033.1 PREDICTED: 40S ribosomal protein S30 [Vitis vinifera] XP_002454730.1 hypothetical protein SORBIDRAFT_04g036360 [Sorghum bicolor] XP_002436569.1 hypothetical protein SORBIDRAFT_10g004940 [Sorghum bicolor] XP_002514177.1 PREDICTED: 40S ribosomal protein S30 [Ricinus communis] XP_002515895.1 PREDICTED: 40S ribosomal protein S30 [Ricinus communis] XP_003517420.1 PREDICTED: 40S ribosomal protein S30 [Glycine max] XP_003525848.1 PREDICTED: 40S ribosomal protein S30 [Glycine max] XP_003538817.1 PREDICTED: 40S ribosomal protein S30 [Glycine max] XP_004135684.1 PREDICTED: 40S ribosomal protein S30 [Cucumis sativus] XP_004141043.1 PREDICTED: 40S ribosomal protein S30 [Cucumis sativus] XP_004251654.1 PREDICTED: 40S ribosomal protein S30 [Solanum lycopersicum] XP_004287748.1 PREDICTED: 40S ribosomal protein S30 [Fragaria vesca subsp. vesca] XP_004297622.1 PREDICTED: 40S ribosomal protein S30 [Fragaria vesca subsp. vesca] XP_004508905.1 PREDICTED: 40S ribosomal protein S30 [Cicer arietinum] XP_004511685.1 PREDICTED: 40S ribosomal protein S30 [Cicer arietinum] XP_006352915.1 PREDICTED: 40S ribosomal protein S30 [Solanum tuberosum] XP_006353513.1 PREDICTED: 40S ribosomal protein S30 [Solanum tuberosum] XP_006475373.1 PREDICTED: 40S ribosomal protein S30 [Citrus sinensis] XP_006853921.1 PREDICTED: 40S ribosomal protein S30 [Amborella trichopoda] XP_007024390.1 PREDICTED: 40S ribosomal protein S30 [Theobroma cacao] XP_007155660.1 hypothetical protein PHAVU_003G220800g [Phaseolus vulgaris] XP_007157355.1 hypothetical protein PHAVU_002G063300g [Phaseolus vulgaris] XP_007215235.1 hypothetical protein PRUPE_ppa014539mg [Prunus persica] XP_008241983.1 PREDICTED: 40S ribosomal protein S30 [Prunus mume] XP_008244746.1 PREDICTED: 40S ribosomal protein S30 [Prunus mume] XP_008459180.1 PREDICTED: 40S ribosomal protein S30 [Cucumis melo] XP_008450806.1 PREDICTED: 40S ribosomal protein S30 [Cucumis melo] XP_009624349.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana tomentosiformis] XP_009626192.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana tomentosiformis] XP_009588124.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana tomentosiformis] XP_009794298.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana sylvestris] XP_009790332.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana sylvestris] XP_010267071.1 PREDICTED: 40S ribosomal protein S30 [Nelumbo nucifera] XP_004245996.2 PREDICTED: 40S ribosomal protein S30 [Solanum lycopersicum] XP_011040498.1 PREDICTED: 40S ribosomal protein S30 [Populus euphratica] XP_011014917.1 PREDICTED: 40S ribosomal protein S30 [Populus euphratica] XP_011085776.1 PREDICTED: 40S ribosomal protein S30 [Sesamum indicum] XP_011093674.1 PREDICTED: 40S ribosomal protein S30 [Sesamum indicum] XP_012076815.1 PREDICTED: 40S ribosomal protein S30 [Jatropha curcas] XP_012831909.1 PREDICTED: 40S ribosomal protein S30 [Erythranthe guttata] XP_012845561.1 PREDICTED: 40S ribosomal protein S30 [Erythranthe guttata] XP_014507978.1 PREDICTED: 40S ribosomal protein S30 [Vigna radiata var. radiata] XP_014520643.1 PREDICTED: 40S ribosomal protein S30 [Vigna radiata var. radiata] XP_015083483.1 PREDICTED: 40S ribosomal protein S30 [Solanum pennellii] XP_015059382.1 PREDICTED: 40S ribosomal protein S30 [Solanum pennellii] XP_015623731.1 PREDICTED: 40S ribosomal protein S30 [Oryza sativa Japonica Group] XP_015644441.1 PREDICTED: 40S ribosomal protein S30 [Oryza sativa Japonica Group] XP_015866631.1 PREDICTED: 40S ribosomal protein S30 [Ziziphus jujuba] XP_015962015.1 PREDICTED: 40S ribosomal protein S30 [Arachis duranensis] XP_015964426.1 PREDICTED: 40S ribosomal protein S30 [Arachis duranensis] XP_016188282.1 PREDICTED: 40S ribosomal protein S30 [Arachis ipaensis] XP_016200666.1 PREDICTED: 40S ribosomal protein S30 [Arachis ipaensis] XP_016474572.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana tabacum] XP_016480718.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana tabacum] XP_016485434.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana tabacum] XP_016507476.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana tabacum] XP_016438944.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana tabacum] XP_016571468.1 PREDICTED: 40S ribosomal protein S30 [Capsicum annuum] XP_017235880.1 PREDICTED: 40S ribosomal protein S30 [Daucus carota subsp. sativus] XP_017240313.1 PREDICTED: 40S ribosomal protein S30 [Daucus carota subsp. sativus] XP_017428506.1 PREDICTED: 40S ribosomal protein S30 [Vigna angularis] XP_017426528.1 PREDICTED: 40S ribosomal protein S30 [Vigna angularis] XP_018843304.1 PREDICTED: 40S ribosomal protein S30 [Juglans regia] XP_018843305.1 PREDICTED: 40S ribosomal protein S30 [Juglans regia] XP_018809943.1 PREDICTED: 40S ribosomal protein S30 [Juglans regia] XP_019056958.1 PREDICTED: 40S ribosomal protein S30 [Tarenaya hassleriana] XP_019058004.1 PREDICTED: 40S ribosomal protein S30 [Tarenaya hassleriana] XP_019058091.1 PREDICTED: 40S ribosomal protein S30 [Tarenaya hassleriana] XP_019058590.1 PREDICTED: 40S ribosomal protein S30 [Tarenaya hassleriana] XP_019249645.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana attenuata] XP_019246883.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana attenuata] XP_019254765.1 PREDICTED: 40S ribosomal protein S30 [Nicotiana attenuata] 3J60_EE Chain e, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s Ribosome BAD19414.1 40S ribosomal protein S30-like [Oryza sativa Japonica Group] BAD36047.1 40S ribosomal protein S30-like [Oryza sativa Japonica Group] BAD72277.1 40S ribosomal protein S30-like [Oryza sativa Japonica Group] BAF18855.1 Os06g0172600 [Oryza sativa Japonica Group] ABK93031.1 unknown [Populus trichocarpa] ABK93458.1 unknown [Populus trichocarpa] ABK93562.1 unknown [Populus trichocarpa] ABK93960.1 unknown [Populus trichocarpa] ABK94037.1 unknown [Populus trichocarpa] ABK95737.1 unknown [Populus trichocarpa] ACG25714.1 40S ribosomal protein S30 [Zea mays] ACG26835.1 40S ribosomal protein S30 [Zea mays] ACG29907.1 40S ribosomal protein S30 [Zea mays] ACG30825.1 40S ribosomal protein S30 [Zea mays] ACG31062.1 40S ribosomal protein S30 [Zea mays] ACG31470.1 40S ribosomal protein S30 [Zea mays] ACG35021.1 40S ribosomal protein S30 [Zea mays] ACG39400.1 40S ribosomal protein S30 [Zea mays] EEE96297.1 40S ribosomal protein S30 [Populus trichocarpa] EEF06329.1 40S ribosomal protein S30 [Populus trichocarpa] EEF46315.1 40S ribosomal protein S30, putative [Ricinus communis] EEF48131.1 40S ribosomal protein S30, putative [Ricinus communis] EER87936.1 hypothetical protein SORBI_010G057100 [Sorghum bicolor] EES07706.1 hypothetical protein SORBI_004G335600 [Sorghum bicolor] ACU20293.1 unknown [Glycine max] AFK44345.1 unknown [Lotus japonicus] AFK48101.1 unknown [Lotus japonicus] AGL08206.1 40s ribosomal protein S30 [Arachis hypogaea] EOY27012.1 Ribosomal protein S30 family protein [Theobroma cacao] ERN15388.1 hypothetical protein AMTR_s00036p00192320 [Amborella trichopoda] ESW27654.1 hypothetical protein PHAVU_003G220800g [Phaseolus vulgaris] ESW29349.1 hypothetical protein PHAVU_002G063300g [Phaseolus vulgaris] EYU30668.1 hypothetical protein MIMGU_mgv1a017625mg [Erythranthe guttata] EYU30669.1 hypothetical protein MIMGU_mgv1a017625mg [Erythranthe guttata] AHY23246.1 hypothetical protein [Fallopia multiflora] KDP33759.1 hypothetical protein JCGZ_07330 [Jatropha curcas] KGN66198.1 hypothetical protein Csa_1G575140 [Cucumis sativus] KHN09823.1 40S ribosomal protein S30 [Glycine soja] KHN34938.1 40S ribosomal protein S30 [Glycine soja] KHN44070.1 40S ribosomal protein S30 [Glycine soja] BAS81446.1 Os02g0804100 [Oryza sativa Japonica Group] BAS96392.1 Os06g0172600 [Oryza sativa Japonica Group] KRH57406.1 hypothetical protein GLYMA_05G059600 [Glycine max] GAU29334.1 hypothetical protein TSUD_227050 [Trifolium subterraneum] GAU27826.1 hypothetical protein TSUD_114060 [Trifolium subterraneum] GAU24499.1 hypothetical protein TSUD_156110 [Trifolium subterraneum] ONH97228.1 hypothetical protein PRUPE_7G177900 [Prunus persica] ONI15656.1 hypothetical protein PRUPE_3G053900 [Prunus persica] AQK75890.1 40S ribosomal protein S30 [Zea mays] AQK84073.1 40S ribosomal protein S30 [Zea mays] Length = 62 Score = 72.0 bits (175), Expect(2) = 2e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 459 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 361 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK Sbjct: 30 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 62 Score = 31.6 bits (70), Expect(2) = 2e-13 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 544 MGKVHGSLARAGKV 503 MGKVHGSLARAGKV Sbjct: 1 MGKVHGSLARAGKV 14 >XP_010086894.1 40S ribosomal protein S30 [Morus notabilis] EXB24685.1 40S ribosomal protein S30 [Morus notabilis] Length = 138 Score = 72.0 bits (175), Expect(2) = 2e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 459 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 361 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK Sbjct: 106 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 138 Score = 31.6 bits (70), Expect(2) = 2e-13 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 544 MGKVHGSLARAGKV 503 MGKVHGSLARAGKV Sbjct: 77 MGKVHGSLARAGKV 90 >XP_010670553.1 PREDICTED: 40S ribosomal protein S30 [Beta vulgaris subsp. vulgaris] XP_010673301.1 PREDICTED: 40S ribosomal protein S30 [Beta vulgaris subsp. vulgaris] KMT14995.1 hypothetical protein BVRB_3g064990 [Beta vulgaris subsp. vulgaris] KMT17004.1 hypothetical protein BVRB_2g042070 [Beta vulgaris subsp. vulgaris] Length = 62 Score = 72.0 bits (175), Expect(2) = 2e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 459 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 361 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK Sbjct: 30 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 62 Score = 31.6 bits (70), Expect(2) = 2e-13 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 544 MGKVHGSLARAGKV 503 MGKVHGSLARAGKV Sbjct: 1 MGKVHGSLARAGKV 14 >KGN60553.1 40S ribosomal protein S30-like [Cucumis sativus] Length = 95 Score = 72.0 bits (175), Expect(2) = 2e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 459 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 361 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK Sbjct: 63 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 95 Score = 31.6 bits (70), Expect(2) = 2e-13 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 544 MGKVHGSLARAGKV 503 MGKVHGSLARAGKV Sbjct: 34 MGKVHGSLARAGKV 47 >XP_009766159.1 PREDICTED: 40S ribosomal protein S30-like [Nicotiana sylvestris] XP_016508997.1 PREDICTED: 40S ribosomal protein S30-like [Nicotiana tabacum] Length = 62 Score = 72.0 bits (175), Expect(2) = 2e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 459 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 361 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK Sbjct: 30 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 62 Score = 31.6 bits (70), Expect(2) = 2e-13 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 544 MGKVHGSLARAGKV 503 MGKVHGSLARAGKV Sbjct: 1 MGKVHGSLARAGKV 14 >CDP14733.1 unnamed protein product [Coffea canephora] Length = 108 Score = 72.0 bits (175), Expect(2) = 2e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 459 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 361 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK Sbjct: 76 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 108 Score = 31.6 bits (70), Expect(2) = 2e-13 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 544 MGKVHGSLARAGKV 503 MGKVHGSLARAGKV Sbjct: 47 MGKVHGSLARAGKV 60 >KDO55923.1 hypothetical protein CISIN_1g042287mg, partial [Citrus sinensis] Length = 97 Score = 72.0 bits (175), Expect(2) = 2e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 459 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 361 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK Sbjct: 65 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 97 Score = 31.6 bits (70), Expect(2) = 2e-13 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 544 MGKVHGSLARAGKV 503 MGKVHGSLARAGKV Sbjct: 36 MGKVHGSLARAGKV 49 >CBI35991.3 unnamed protein product, partial [Vitis vinifera] Length = 113 Score = 72.0 bits (175), Expect(2) = 2e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 459 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 361 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK Sbjct: 81 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 113 Score = 31.6 bits (70), Expect(2) = 2e-13 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 544 MGKVHGSLARAGKV 503 MGKVHGSLARAGKV Sbjct: 52 MGKVHGSLARAGKV 65 >EYU41614.1 hypothetical protein MIMGU_mgv1a016770mg [Erythranthe guttata] Length = 107 Score = 72.0 bits (175), Expect(2) = 2e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 459 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 361 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK Sbjct: 75 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 107 Score = 31.6 bits (70), Expect(2) = 2e-13 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 544 MGKVHGSLARAGKV 503 MGKVHGSLARAGKV Sbjct: 46 MGKVHGSLARAGKV 59 >XP_006451370.1 hypothetical protein CICLE_v10009868mg [Citrus clementina] ESR64610.1 hypothetical protein CICLE_v10009868mg [Citrus clementina] Length = 133 Score = 72.0 bits (175), Expect(2) = 2e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 459 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 361 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK Sbjct: 101 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 133 Score = 31.6 bits (70), Expect(2) = 2e-13 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 544 MGKVHGSLARAGKV 503 MGKVHGSLARAGKV Sbjct: 72 MGKVHGSLARAGKV 85 >OEL35698.1 40S ribosomal protein S30, partial [Dichanthelium oligosanthes] Length = 61 Score = 72.0 bits (175), Expect = 3e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 459 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 361 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK Sbjct: 29 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 61 >EPS69967.1 hypothetical protein M569_04801, partial [Genlisea aurea] Length = 61 Score = 72.0 bits (175), Expect = 3e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 459 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 361 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK Sbjct: 29 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 61 >OEL26885.1 40S ribosomal protein S30, partial [Dichanthelium oligosanthes] Length = 63 Score = 72.0 bits (175), Expect = 3e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 459 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 361 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK Sbjct: 31 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 63 >KOM44808.1 hypothetical protein LR48_Vigan06g011400, partial [Vigna angularis] Length = 64 Score = 72.0 bits (175), Expect = 3e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 459 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 361 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK Sbjct: 32 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 64 >XP_006858925.1 PREDICTED: 40S ribosomal protein S30 [Amborella trichopoda] ERN20392.1 hypothetical protein AMTR_s00068p00064720 [Amborella trichopoda] Length = 62 Score = 71.6 bits (174), Expect(2) = 3e-13 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -2 Query: 459 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 361 PRGRAHKRMQYNRRFVTAV+GFGKKRGPNSSEK Sbjct: 30 PRGRAHKRMQYNRRFVTAVIGFGKKRGPNSSEK 62 Score = 31.6 bits (70), Expect(2) = 3e-13 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = -1 Query: 544 MGKVHGSLARAGKV 503 MGKVHGSLARAGKV Sbjct: 1 MGKVHGSLARAGKV 14 >KYP67165.1 40S ribosomal protein S30 [Cajanus cajan] Length = 65 Score = 72.0 bits (175), Expect = 3e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -2 Query: 459 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 361 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK Sbjct: 33 PRGRAHKRMQYNRRFVTAVVGFGKKRGPNSSEK 65