BLASTX nr result
ID: Lithospermum23_contig00000359
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum23_contig00000359 (619 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP20562.1 unnamed protein product [Coffea canephora] 54 8e-06 >CDP20562.1 unnamed protein product [Coffea canephora] Length = 159 Score = 53.9 bits (128), Expect(2) = 8e-06 Identities = 23/32 (71%), Positives = 26/32 (81%) Frame = -2 Query: 540 KSTKRPREKEVKRCSCNGCNKKLGLMGFRCRC 445 +S KRPR+ V RCSC GC +KLGLMGFRCRC Sbjct: 86 RSLKRPRDA-VNRCSCTGCRRKLGLMGFRCRC 116 Score = 23.5 bits (49), Expect(2) = 8e-06 Identities = 9/11 (81%), Positives = 11/11 (100%) Frame = -1 Query: 385 AGKEAIAKENP 353 AG+EAIA+ENP Sbjct: 139 AGREAIARENP 149