BLASTX nr result
ID: Lithospermum22_contig00047842
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00047842 (245 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003544295.1| PREDICTED: zinc finger CCCH domain-containin... 47 1e-06 >ref|XP_003544295.1| PREDICTED: zinc finger CCCH domain-containing protein 66-like [Glycine max] Length = 1089 Score = 47.0 bits (110), Expect(2) = 1e-06 Identities = 18/52 (34%), Positives = 31/52 (59%) Frame = -3 Query: 159 HLFLQCHHSAIIWRKLLMYMNELHQPQDWNFEMKWIAEKEMGKSFRSRLRRS 4 HL +C IW+K+L ++N H+P W E+ WI + GK+++SR ++ Sbjct: 304 HLLFECGEMYAIWKKVLDWLNVDHEPAGWLQELDWIEDTSKGKNWKSRFLKT 355 Score = 30.0 bits (66), Expect(2) = 1e-06 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = -2 Query: 241 RLPTKDRLLSWGVIEDDICCYCQD 170 RL TK+RL +G++ D C +C++ Sbjct: 275 RLATKERLYRFGIVNDARCAFCEE 298