BLASTX nr result
ID: Lithospermum22_contig00047677
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00047677 (259 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003524273.1| PREDICTED: uncharacterized protein LOC100805... 59 5e-07 ref|XP_003532838.1| PREDICTED: uncharacterized protein LOC100791... 57 2e-06 ref|XP_003630055.1| DNA polymerase III polC-type [Medicago trunc... 56 4e-06 >ref|XP_003524273.1| PREDICTED: uncharacterized protein LOC100805245 [Glycine max] Length = 276 Score = 58.5 bits (140), Expect = 5e-07 Identities = 31/55 (56%), Positives = 37/55 (67%), Gaps = 4/55 (7%) Frame = -3 Query: 245 RKSPPATTSISYQRTVPYTT----RLTTRVKEIICKAQCNKPLNNFFRHSHSLLR 93 RKSPP TS YQRTVPY ++T RVK ++CKAQ PL + +HSHSLLR Sbjct: 224 RKSPP--TSYGYQRTVPYARGSLGKVTERVKGLLCKAQGQPPLQHLLKHSHSLLR 276 >ref|XP_003532838.1| PREDICTED: uncharacterized protein LOC100791906 [Glycine max] Length = 276 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/55 (54%), Positives = 36/55 (65%), Gaps = 4/55 (7%) Frame = -3 Query: 245 RKSPPATTSISYQRTVPYTT----RLTTRVKEIICKAQCNKPLNNFFRHSHSLLR 93 RKSPPAT + YQRTVPY ++T VK ++CKAQ PL +HSHSLLR Sbjct: 224 RKSPPAT--LGYQRTVPYARGSLGKVTESVKGLLCKAQGQPPLQQLLKHSHSLLR 276 >ref|XP_003630055.1| DNA polymerase III polC-type [Medicago truncatula] gi|355524077|gb|AET04531.1| DNA polymerase III polC-type [Medicago truncatula] Length = 281 Score = 55.8 bits (133), Expect = 4e-06 Identities = 29/55 (52%), Positives = 37/55 (67%), Gaps = 4/55 (7%) Frame = -3 Query: 245 RKSPPATTSISYQRTVPYTT----RLTTRVKEIICKAQCNKPLNNFFRHSHSLLR 93 RKSPPA++S YQRTVPY ++ R+K ++CKAQ PL +HSHSLLR Sbjct: 229 RKSPPASSS--YQRTVPYARGSLGKVAERMKGLLCKAQGQPPLQQLLKHSHSLLR 281