BLASTX nr result
ID: Lithospermum22_contig00047670
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00047670 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002323687.1| predicted protein [Populus trichocarpa] gi|2... 61 8e-08 >ref|XP_002323687.1| predicted protein [Populus trichocarpa] gi|222868317|gb|EEF05448.1| predicted protein [Populus trichocarpa] Length = 305 Score = 61.2 bits (147), Expect = 8e-08 Identities = 30/55 (54%), Positives = 38/55 (69%) Frame = -2 Query: 165 MLQFLTCLVSFPRVIKTQLSTEPVNSARELDIHLQDYAYRAFIRPKTGVVYDGSV 1 ML LT +V P +I + +NSAR LD LQDYAYRAF+RP+TG+ YDG+V Sbjct: 1 MLSLLTLIVWLPGII-----AQSINSARPLDALLQDYAYRAFVRPRTGIAYDGTV 50