BLASTX nr result
ID: Lithospermum22_contig00047553
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00047553 (293 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535305.1| conserved hypothetical protein [Ricinus comm... 70 2e-10 ref|XP_002539361.1| conserved hypothetical protein [Ricinus comm... 59 2e-08 ref|XP_002334101.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 >ref|XP_002535305.1| conserved hypothetical protein [Ricinus communis] gi|223523491|gb|EEF27078.1| conserved hypothetical protein [Ricinus communis] Length = 183 Score = 69.7 bits (169), Expect = 2e-10 Identities = 34/39 (87%), Positives = 34/39 (87%) Frame = +3 Query: 15 LRLLRQAVDSFIREGKKEPKHGRCRTLEWQRKARPSLFF 131 LRLLRQAVDSFIREGKK PKH RCRTLEWQRKA LFF Sbjct: 116 LRLLRQAVDSFIREGKKGPKHLRCRTLEWQRKAGSYLFF 154 Score = 68.2 bits (165), Expect = 7e-10 Identities = 33/42 (78%), Positives = 34/42 (80%) Frame = +1 Query: 94 LSGKGKRDLLFFFQACSDIRFPRKIKLVSRVMGNLPARFGEH 219 L + K FFQACSDIRFPRKIKLVSRVMGNLPARFGEH Sbjct: 142 LEWQRKAGSYLFFQACSDIRFPRKIKLVSRVMGNLPARFGEH 183 >ref|XP_002539361.1| conserved hypothetical protein [Ricinus communis] gi|223506854|gb|EEF23023.1| conserved hypothetical protein [Ricinus communis] Length = 62 Score = 59.3 bits (142), Expect(2) = 2e-08 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = +3 Query: 96 EWQRKARPSLFFPGLFGHTVPAEDQVGEPCDGKPSRT 206 EWQRKA LF + GHTVPAEDQVGEPCDGKPSRT Sbjct: 5 EWQRKAGSYLFSRPV-GHTVPAEDQVGEPCDGKPSRT 40 Score = 23.9 bits (50), Expect(2) = 2e-08 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +2 Query: 263 GSSLDSQIGP 292 GSSLDSQIGP Sbjct: 41 GSSLDSQIGP 50 >ref|XP_002334101.1| predicted protein [Populus trichocarpa] gi|222869592|gb|EEF06723.1| predicted protein [Populus trichocarpa] Length = 69 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -3 Query: 231 HSNSVLSEPCGKVSHHTAHQLDLPR 157 HSNSVLSEPCGKVSHHTAH+LDLPR Sbjct: 14 HSNSVLSEPCGKVSHHTAHRLDLPR 38