BLASTX nr result
ID: Lithospermum22_contig00047474
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00047474 (284 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003541522.1| PREDICTED: uncharacterized protein LOC100783... 57 1e-06 emb|CBI40035.3| unnamed protein product [Vitis vinifera] 55 4e-06 emb|CAN79394.1| hypothetical protein VITISV_010429 [Vitis vinifera] 55 4e-06 ref|XP_002275536.2| PREDICTED: uncharacterized protein LOC100245... 55 6e-06 ref|XP_003593050.1| Vacuolar protein sorting-associated protein ... 55 8e-06 >ref|XP_003541522.1| PREDICTED: uncharacterized protein LOC100783352 [Glycine max] Length = 3441 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/30 (83%), Positives = 30/30 (100%) Frame = -3 Query: 90 QLFGSAGVLGNPIGFARSVGLGIKDFLSVP 1 +LFGSAGV+GNP+GFARS+GLGI+DFLSVP Sbjct: 3083 KLFGSAGVIGNPLGFARSMGLGIRDFLSVP 3112 >emb|CBI40035.3| unnamed protein product [Vitis vinifera] Length = 2796 Score = 55.5 bits (132), Expect = 4e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -3 Query: 90 QLFGSAGVLGNPIGFARSVGLGIKDFLSVP 1 ++FGSAGV+GNP+GF RSVGLGIKDFLS P Sbjct: 2434 KVFGSAGVIGNPVGFIRSVGLGIKDFLSAP 2463 >emb|CAN79394.1| hypothetical protein VITISV_010429 [Vitis vinifera] Length = 879 Score = 55.5 bits (132), Expect = 4e-06 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -3 Query: 90 QLFGSAGVLGNPIGFARSVGLGIKDFLSVP 1 ++FGSAGV+GNP+GF RSVGLGIKDFLS P Sbjct: 522 KVFGSAGVIGNPVGFIRSVGLGIKDFLSAP 551 >ref|XP_002275536.2| PREDICTED: uncharacterized protein LOC100245550 [Vitis vinifera] Length = 4054 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -3 Query: 87 LFGSAGVLGNPIGFARSVGLGIKDFLSVP 1 +FGSAGV+GNP+GF RSVGLGIKDFLS P Sbjct: 3693 VFGSAGVIGNPVGFIRSVGLGIKDFLSAP 3721 >ref|XP_003593050.1| Vacuolar protein sorting-associated protein [Medicago truncatula] gi|355482098|gb|AES63301.1| Vacuolar protein sorting-associated protein [Medicago truncatula] Length = 3201 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/30 (80%), Positives = 29/30 (96%) Frame = -3 Query: 90 QLFGSAGVLGNPIGFARSVGLGIKDFLSVP 1 +LFGSAGV+GNP+GFARS+G GI+DFLSVP Sbjct: 2835 KLFGSAGVIGNPLGFARSMGHGIRDFLSVP 2864