BLASTX nr result
ID: Lithospermum22_contig00047346
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00047346 (286 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631603.1| PREDICTED: putative pentatricopeptide repeat... 57 1e-06 ref|XP_003539025.1| PREDICTED: putative pentatricopeptide repeat... 56 3e-06 >ref|XP_003631603.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g18840-like [Vitis vinifera] Length = 670 Score = 57.4 bits (137), Expect = 1e-06 Identities = 24/47 (51%), Positives = 32/47 (68%) Frame = +1 Query: 7 EKEVKKTTGCSWIHIGERVHTFTSSDRSHSEIDAIYFVISCLIQELD 147 E E+KK GCSW+++ RVH FTS D SHS +AIY ++ L EL+ Sbjct: 620 ENEIKKFAGCSWVYVENRVHIFTSGDSSHSSAEAIYSILLILTAELN 666 >ref|XP_003539025.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g18840-like [Glycine max] Length = 681 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/59 (44%), Positives = 38/59 (64%) Frame = +1 Query: 13 EVKKTTGCSWIHIGERVHTFTSSDRSHSEIDAIYFVISCLIQELDAIRLTEERILEESQ 189 E KK GCSWI++ +H FTS DRSHS+ +A+Y ++CL +L + E++ L E Q Sbjct: 619 EAKKLAGCSWIYVENGIHVFTSGDRSHSKAEAVYSTLTCLNGKL-YLSFKEQKQLYEIQ 676