BLASTX nr result
ID: Lithospermum22_contig00047334
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00047334 (360 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534489.1| conserved hypothetical protein [Ricinus comm... 45 6e-06 >ref|XP_002534489.1| conserved hypothetical protein [Ricinus communis] gi|223525202|gb|EEF27893.1| conserved hypothetical protein [Ricinus communis] Length = 295 Score = 45.1 bits (105), Expect(2) = 6e-06 Identities = 18/45 (40%), Positives = 29/45 (64%), Gaps = 4/45 (8%) Frame = -1 Query: 132 NTIPKKV----WKKIWKLPFPQKIKVFIWKVLLNRLPTKDNLEKK 10 N++P + WK++WK+ P KIKVF+W++L N LP L+ + Sbjct: 188 NSLPSSLARHGWKQLWKMKVPDKIKVFLWEMLANALPVGSLLQSR 232 Score = 29.6 bits (65), Expect(2) = 6e-06 Identities = 15/32 (46%), Positives = 19/32 (59%) Frame = -2 Query: 314 SWNIVLLKILFPTKIVNEILKIRLSNSKDTRI 219 SW I LL FP V EI+KI LS ++D + Sbjct: 159 SWEIALLHQHFPPHQVAEIIKIPLSENQDNSL 190