BLASTX nr result
ID: Lithospermum22_contig00047328
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00047328 (229 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521663.1| pentatricopeptide repeat-containing protein,... 99 3e-19 ref|XP_003593286.1| Pentatricopeptide repeat-containing protein ... 94 1e-17 ref|XP_003547103.1| PREDICTED: pentatricopeptide repeat-containi... 86 3e-15 sp|O65543.2|PP343_ARATH RecName: Full=Pentatricopeptide repeat-c... 80 2e-13 ref|NP_194836.1| pentatricopeptide repeat-containing protein [Ar... 80 2e-13 >ref|XP_002521663.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223539054|gb|EEF40650.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 578 Score = 99.4 bits (246), Expect = 3e-19 Identities = 46/74 (62%), Positives = 57/74 (77%) Frame = +3 Query: 3 KLEDVIDIVRKMPIKPSTKVWSSLVSACKLHERMEIAETLARELIKEEPDNDTNYKLLSM 182 K++D DI+R MP+KPST +WSSLVSACK+H R+EIAE LA+ELIK EP N N+ LLSM Sbjct: 483 KVDDAFDILRAMPMKPSTTIWSSLVSACKIHGRLEIAERLAQELIKSEPSNAANHTLLSM 542 Query: 183 VKAERDNWHGVQKV 224 + AE NW V+ V Sbjct: 543 IYAESGNWFAVEDV 556 >ref|XP_003593286.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355482334|gb|AES63537.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 622 Score = 94.0 bits (232), Expect = 1e-17 Identities = 40/74 (54%), Positives = 60/74 (81%) Frame = +3 Query: 3 KLEDVIDIVRKMPIKPSTKVWSSLVSACKLHERMEIAETLARELIKEEPDNDTNYKLLSM 182 KLED ++I+R MP+KPS ++WSSLVS+CKLH R++IAE+L+ +LI+ EP+N +Y LLSM Sbjct: 527 KLEDALEILRTMPMKPSARIWSSLVSSCKLHGRLDIAESLSSQLIRSEPNNAASYTLLSM 586 Query: 183 VKAERDNWHGVQKV 224 + AE+ W +++V Sbjct: 587 IHAEKGRWLDIEQV 600 >ref|XP_003547103.1| PREDICTED: pentatricopeptide repeat-containing protein At4g31070, mitochondrial-like [Glycine max] Length = 601 Score = 85.9 bits (211), Expect = 3e-15 Identities = 40/74 (54%), Positives = 55/74 (74%) Frame = +3 Query: 3 KLEDVIDIVRKMPIKPSTKVWSSLVSACKLHERMEIAETLARELIKEEPDNDTNYKLLSM 182 KLE ++I R MP+KPS ++WSSLVSACKLH R++IAE LA +LI+ EP+N NY LL+ Sbjct: 508 KLEYALEIRRTMPMKPSARIWSSLVSACKLHGRLDIAEMLAPQLIRSEPNNAGNYTLLNT 567 Query: 183 VKAERDNWHGVQKV 224 + AE +W ++V Sbjct: 568 IYAEHGHWLDTEQV 581 >sp|O65543.2|PP343_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At4g31070, mitochondrial; Flags: Precursor Length = 624 Score = 80.1 bits (196), Expect = 2e-13 Identities = 34/75 (45%), Positives = 53/75 (70%), Gaps = 1/75 (1%) Frame = +3 Query: 3 KLEDVIDIVRKMPIKPSTKVWSSLVSACKLHERMEIA-ETLARELIKEEPDNDTNYKLLS 179 K++D ++ MP+KPS ++WSSL+SAC+ H R+++A + +A EL+K EPDN NY LLS Sbjct: 515 KIDDAFEVTINMPMKPSARIWSSLLSACETHGRLDVAGKIIANELMKSEPDNPANYVLLS 574 Query: 180 MVKAERDNWHGVQKV 224 + E N+H ++V Sbjct: 575 KIHTESGNYHAAEEV 589 >ref|NP_194836.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|2980759|emb|CAA18186.1| putative protein [Arabidopsis thaliana] gi|7270009|emb|CAB79825.1| putative protein [Arabidopsis thaliana] gi|332660453|gb|AEE85853.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 613 Score = 80.1 bits (196), Expect = 2e-13 Identities = 34/75 (45%), Positives = 53/75 (70%), Gaps = 1/75 (1%) Frame = +3 Query: 3 KLEDVIDIVRKMPIKPSTKVWSSLVSACKLHERMEIA-ETLARELIKEEPDNDTNYKLLS 179 K++D ++ MP+KPS ++WSSL+SAC+ H R+++A + +A EL+K EPDN NY LLS Sbjct: 504 KIDDAFEVTINMPMKPSARIWSSLLSACETHGRLDVAGKIIANELMKSEPDNPANYVLLS 563 Query: 180 MVKAERDNWHGVQKV 224 + E N+H ++V Sbjct: 564 KIHTESGNYHAAEEV 578