BLASTX nr result
ID: Lithospermum22_contig00047082
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00047082 (381 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA65995.1| hypothetical protein [Beta vulgaris subsp. vulga... 49 1e-06 >emb|CCA65995.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1389 Score = 48.9 bits (115), Expect(2) = 1e-06 Identities = 24/50 (48%), Positives = 30/50 (60%), Gaps = 3/50 (6%) Frame = +1 Query: 220 SPGPDGFPESFFQTCWHIIGSDICKAILFF---P*RLNELLFYFITLIPK 360 SPGPDGFP FFQ W +IG +C+A+ F L E+ F+ LIPK Sbjct: 461 SPGPDGFPPYFFQKYWTLIGKSVCRAVQAFFHSGYMLKEVNHTFLALIPK 510 Score = 28.1 bits (61), Expect(2) = 1e-06 Identities = 12/23 (52%), Positives = 17/23 (73%) Frame = +3 Query: 144 SEDDNAFLTAMPDEDEIKSTVFE 212 SE DNA+LT+ +EIK+ VF+ Sbjct: 433 SEADNAYLTSAVSPEEIKNAVFD 455