BLASTX nr result
ID: Lithospermum22_contig00047070
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00047070 (288 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002444604.1| hypothetical protein SORBIDRAFT_07g024540 [S... 55 5e-06 ref|XP_002450718.1| hypothetical protein SORBIDRAFT_05g015090 [S... 55 5e-06 >ref|XP_002444604.1| hypothetical protein SORBIDRAFT_07g024540 [Sorghum bicolor] gi|241940954|gb|EES14099.1| hypothetical protein SORBIDRAFT_07g024540 [Sorghum bicolor] Length = 1185 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/45 (55%), Positives = 34/45 (75%) Frame = -2 Query: 284 G*TLDCVGLYLRQPVFARGQLYVALSRARTGCSVKVLILPPTYKD 150 G T+ VG+YL +PVF+ GQLYVALSRA ++K+L++PP KD Sbjct: 1114 GQTIPTVGVYLPEPVFSHGQLYVALSRATARSNIKILVVPPDEKD 1158 >ref|XP_002450718.1| hypothetical protein SORBIDRAFT_05g015090 [Sorghum bicolor] gi|241936561|gb|EES09706.1| hypothetical protein SORBIDRAFT_05g015090 [Sorghum bicolor] Length = 994 Score = 55.5 bits (132), Expect = 5e-06 Identities = 25/45 (55%), Positives = 34/45 (75%) Frame = -2 Query: 284 G*TLDCVGLYLRQPVFARGQLYVALSRARTGCSVKVLILPPTYKD 150 G T+ VG+YL +PVF+ GQLYVALSRA ++K+L++PP KD Sbjct: 923 GQTIPTVGVYLPEPVFSHGQLYVALSRATARSNIKILVVPPDEKD 967