BLASTX nr result
ID: Lithospermum22_contig00047003
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00047003 (302 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003589393.1| Cytochrome P450 [Medicago truncatula] gi|355... 63 2e-08 ref|XP_003589391.1| Cytochrome P450 [Medicago truncatula] gi|355... 63 2e-08 ref|XP_002278387.1| PREDICTED: cytochrome P450 71A1 [Vitis vinif... 60 1e-07 ref|NP_001234847.1| cytochrome P450 71 family protein [Solanum l... 60 2e-07 ref|XP_003516815.1| PREDICTED: cytochrome P450 83B1-like [Glycin... 56 3e-06 >ref|XP_003589393.1| Cytochrome P450 [Medicago truncatula] gi|355478441|gb|AES59644.1| Cytochrome P450 [Medicago truncatula] Length = 514 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = +3 Query: 126 LQNLPYCKAIIKETPIFYPPVPLLIPR*TIGSCMIDGYEIQPKTSV 263 ++ LPY K+++KET +PP PLL+PR TI SC IDGYEI+PKT V Sbjct: 360 IEKLPYLKSVVKETLRLFPPSPLLLPRETIESCNIDGYEIKPKTLV 405 >ref|XP_003589391.1| Cytochrome P450 [Medicago truncatula] gi|355478439|gb|AES59642.1| Cytochrome P450 [Medicago truncatula] Length = 538 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/46 (60%), Positives = 36/46 (78%) Frame = +3 Query: 126 LQNLPYCKAIIKETPIFYPPVPLLIPR*TIGSCMIDGYEIQPKTSV 263 ++ LPY K+++KET +PP PLL+PR TI SC IDGYEI+PKT V Sbjct: 384 IEKLPYLKSVVKETLRLFPPSPLLLPRETIESCNIDGYEIKPKTLV 429 >ref|XP_002278387.1| PREDICTED: cytochrome P450 71A1 [Vitis vinifera] Length = 494 Score = 60.5 bits (145), Expect = 1e-07 Identities = 45/111 (40%), Positives = 58/111 (52%), Gaps = 12/111 (10%) Frame = +1 Query: 4 VLMNLFIAGTDTSAAVANW-MTALMKTPLAMKSAQAEVRESVCKIYHIAKPS*KRLQY-- 174 +LM++FIAGTDTSAA W MT LMK P+ MK AQ E R S+ K + + + L Y Sbjct: 290 ILMDIFIAGTDTSAATLVWAMTELMKNPIVMKKAQEEFRNSIGKKGFVDEDDLQMLCYLK 349 Query: 175 -SILQCLS*YQGKQLEVA**MDMKS-------NPKP-QFVNVWAIGRDPEY 300 + + + + L V K PK FVN WAIGRDPE+ Sbjct: 350 ALVKETMRLHPAAPLLVPRETREKCVIDGYEIAPKTLVFVNAWAIGRDPEF 400 >ref|NP_001234847.1| cytochrome P450 71 family protein [Solanum lycopersicum] gi|255762735|gb|ACU33178.1| cytochrome P450 71 family protein [Solanum lycopersicum] Length = 495 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = +3 Query: 126 LQNLPYCKAIIKETPIFYPPVPLLIPR*TIGSCMIDGYEIQPKTSV 263 LQ+L Y KA+IKET +PPVPLL+PR +I C IDGYE+ KT V Sbjct: 342 LQHLHYMKAVIKETMRLHPPVPLLVPRESIEKCSIDGYEVPAKTRV 387 >ref|XP_003516815.1| PREDICTED: cytochrome P450 83B1-like [Glycine max] Length = 501 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/46 (58%), Positives = 32/46 (69%) Frame = +3 Query: 126 LQNLPYCKAIIKETPIFYPPVPLLIPR*TIGSCMIDGYEIQPKTSV 263 +Q LPY +A+IKET YPP+PLL+ R TI C I GYEI KT V Sbjct: 349 IQKLPYVQAVIKETMRIYPPLPLLLQRETIKKCSIAGYEIPEKTLV 394