BLASTX nr result
ID: Lithospermum22_contig00046996
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00046996 (351 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004137015.1| PREDICTED: F-box/kelch-repeat protein At1g16... 55 8e-06 >ref|XP_004137015.1| PREDICTED: F-box/kelch-repeat protein At1g16250-like [Cucumis sativus] gi|449479183|ref|XP_004155528.1| PREDICTED: F-box/kelch-repeat protein At1g16250-like [Cucumis sativus] Length = 352 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = -2 Query: 338 SGMRSEVHVFDTLTNGNRWRSLEPIFDDGGEKFLCCHCCVL 216 S M S VHVF+T NG+ WRS+EP+ +D GEK LC HCCV+ Sbjct: 309 SRMTSVVHVFNTSANGDAWRSMEPMEED-GEKELCSHCCVV 348