BLASTX nr result
ID: Lithospermum22_contig00046980
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00046980 (336 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002519389.1| pentatricopeptide repeat-containing protein,... 83 3e-14 ref|XP_003538652.1| PREDICTED: pentatricopeptide repeat-containi... 82 3e-14 ref|XP_003610808.1| Pentatricopeptide repeat-containing protein ... 81 1e-13 ref|XP_002269080.1| PREDICTED: pentatricopeptide repeat-containi... 80 2e-13 emb|CBI39176.3| unnamed protein product [Vitis vinifera] 80 2e-13 >ref|XP_002519389.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223541456|gb|EEF43006.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 634 Score = 82.8 bits (203), Expect = 3e-14 Identities = 40/75 (53%), Positives = 56/75 (74%), Gaps = 1/75 (1%) Frame = -1 Query: 336 FTSRDEKIYSSLIESCSHH-NVNKAFELYSEMTKRALVPELSTFVHLVKGLIAIGRWEEA 160 F++ + Y SLIES + V+KAF+LYS+MT+R VPELS V L+KGL+ +G+WEEA Sbjct: 551 FSAAYQNTYVSLIESLTLACKVDKAFKLYSDMTRRGFVPELSMLVCLIKGLLRVGKWEEA 610 Query: 159 LELCESLCYMDICWI 115 L+L +S+C MDI W+ Sbjct: 611 LQLSDSICQMDIHWV 625 >ref|XP_003538652.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial-like [Glycine max] Length = 1024 Score = 82.4 bits (202), Expect = 3e-14 Identities = 39/68 (57%), Positives = 55/68 (80%), Gaps = 1/68 (1%) Frame = -1 Query: 315 IYSSLIESCSHHN-VNKAFELYSEMTKRALVPELSTFVHLVKGLIAIGRWEEALELCESL 139 +Y+SLIES SH + V+KAFELY+ M + +VPELSTFVHL+KGL +G+W+EAL+L +S+ Sbjct: 891 LYTSLIESLSHASKVDKAFELYASMINKNVVPELSTFVHLIKGLTRVGKWQEALQLSDSI 950 Query: 138 CYMDICWI 115 C M +C + Sbjct: 951 CQM-VCHV 957 >ref|XP_003610808.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355512143|gb|AES93766.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 1084 Score = 80.9 bits (198), Expect = 1e-13 Identities = 37/68 (54%), Positives = 53/68 (77%), Gaps = 1/68 (1%) Frame = -1 Query: 315 IYSSLIESCSHHN-VNKAFELYSEMTKRALVPELSTFVHLVKGLIAIGRWEEALELCESL 139 +Y+SLIE+ SH + V+KA ELY+ M + +VPELS VHL+KGLI + +W+EAL+L +S+ Sbjct: 898 LYASLIENLSHASKVDKALELYASMISKNVVPELSILVHLIKGLIKVDKWQEALQLSDSI 957 Query: 138 CYMDICWI 115 C MDI W+ Sbjct: 958 CQMDIHWL 965 >ref|XP_002269080.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06710, mitochondrial-like [Vitis vinifera] Length = 1045 Score = 80.1 bits (196), Expect = 2e-13 Identities = 40/75 (53%), Positives = 56/75 (74%), Gaps = 1/75 (1%) Frame = -1 Query: 336 FTSRDEKIYSSLIESCS-HHNVNKAFELYSEMTKRALVPELSTFVHLVKGLIAIGRWEEA 160 +++ D+ +YSSLIES S V+KAFELY++M KR +PELS F +LVKGLI I RWEEA Sbjct: 911 YSAADKDLYSSLIESLSLASKVDKAFELYADMIKRGGIPELSIFFYLVKGLIRINRWEEA 970 Query: 159 LELCESLCYMDICWI 115 L+L + +C M + ++ Sbjct: 971 LQLSDCICQMMVDFV 985 >emb|CBI39176.3| unnamed protein product [Vitis vinifera] Length = 996 Score = 79.7 bits (195), Expect = 2e-13 Identities = 40/70 (57%), Positives = 53/70 (75%), Gaps = 1/70 (1%) Frame = -1 Query: 336 FTSRDEKIYSSLIESCS-HHNVNKAFELYSEMTKRALVPELSTFVHLVKGLIAIGRWEEA 160 +++ D+ +YSSLIES S V+KAFELY++M KR +PELS F +LVKGLI I RWEEA Sbjct: 911 YSAADKDLYSSLIESLSLASKVDKAFELYADMIKRGGIPELSIFFYLVKGLIRINRWEEA 970 Query: 159 LELCESLCYM 130 L+L + +C M Sbjct: 971 LQLSDCICQM 980