BLASTX nr result
ID: Lithospermum22_contig00046900
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00046900 (247 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277595.2| PREDICTED: cytochrome P450 76A2-like [Vitis ... 123 2e-26 emb|CBI30230.3| unnamed protein product [Vitis vinifera] 123 2e-26 sp|P37121.1|C76A1_SOLME RecName: Full=Cytochrome P450 76A1; AltN... 122 3e-26 ref|XP_002528652.1| conserved hypothetical protein [Ricinus comm... 121 5e-26 ref|XP_002528653.1| cytochrome P450, putative [Ricinus communis]... 121 7e-26 >ref|XP_002277595.2| PREDICTED: cytochrome P450 76A2-like [Vitis vinifera] Length = 332 Score = 123 bits (308), Expect = 2e-26 Identities = 54/71 (76%), Positives = 66/71 (92%), Gaps = 1/71 (1%) Frame = +2 Query: 2 AIGRDPEHWEEPFSFKPERFIDSK-VDYKGQHFELLPFGAGRRICAGIPLAHRMLHLVLG 178 AIGRDP WE+P SFKPERF+DSK ++YKGQ+FEL+PFGAGRRICAGIPLAHR+LHLVLG Sbjct: 230 AIGRDPGSWEDPSSFKPERFLDSKKIEYKGQNFELIPFGAGRRICAGIPLAHRVLHLVLG 289 Query: 179 SMLHEFDWEVQ 211 ++LH FDW+++ Sbjct: 290 TLLHHFDWQLK 300 >emb|CBI30230.3| unnamed protein product [Vitis vinifera] Length = 533 Score = 123 bits (308), Expect = 2e-26 Identities = 54/71 (76%), Positives = 66/71 (92%), Gaps = 1/71 (1%) Frame = +2 Query: 2 AIGRDPEHWEEPFSFKPERFIDSK-VDYKGQHFELLPFGAGRRICAGIPLAHRMLHLVLG 178 AIGRDP WE+P SFKPERF+DSK ++YKGQ+FEL+PFGAGRRICAGIPLAHR+LHLVLG Sbjct: 143 AIGRDPGSWEDPSSFKPERFLDSKKIEYKGQNFELIPFGAGRRICAGIPLAHRVLHLVLG 202 Query: 179 SMLHEFDWEVQ 211 ++LH FDW+++ Sbjct: 203 TLLHHFDWQLK 213 Score = 105 bits (263), Expect = 3e-21 Identities = 45/69 (65%), Positives = 58/69 (84%) Frame = +2 Query: 2 AIGRDPEHWEEPFSFKPERFIDSKVDYKGQHFELLPFGAGRRICAGIPLAHRMLHLVLGS 181 AIGRDP+ W+EP SFKP+RF+ S +DYKGQ+FE +PFG+GRRIC GI LA+++L L L S Sbjct: 431 AIGRDPDAWKEPLSFKPDRFLGSNLDYKGQNFEFIPFGSGRRICIGISLANKLLPLALAS 490 Query: 182 MLHEFDWEV 208 +LH FDWE+ Sbjct: 491 LLHCFDWEL 499 >sp|P37121.1|C76A1_SOLME RecName: Full=Cytochrome P450 76A1; AltName: Full=CYPLXXVIA1; AltName: Full=Cytochrome P-450EG8 gi|1345576|emb|CAA50649.1| unnamed protein product [Solanum melongena] Length = 467 Score = 122 bits (306), Expect = 3e-26 Identities = 49/69 (71%), Positives = 61/69 (88%) Frame = +2 Query: 2 AIGRDPEHWEEPFSFKPERFIDSKVDYKGQHFELLPFGAGRRICAGIPLAHRMLHLVLGS 181 AIGRDPE+W+ PF FKPERF++SKVD KGQ++EL+PFGAGRR+C G+PL HRM+H GS Sbjct: 367 AIGRDPEYWDNPFEFKPERFLESKVDVKGQNYELIPFGAGRRMCVGLPLGHRMMHFTFGS 426 Query: 182 MLHEFDWEV 208 +LHEFDWE+ Sbjct: 427 LLHEFDWEL 435 >ref|XP_002528652.1| conserved hypothetical protein [Ricinus communis] gi|223531941|gb|EEF33755.1| conserved hypothetical protein [Ricinus communis] Length = 187 Score = 121 bits (304), Expect = 5e-26 Identities = 54/82 (65%), Positives = 64/82 (78%) Frame = +2 Query: 2 AIGRDPEHWEEPFSFKPERFIDSKVDYKGQHFELLPFGAGRRICAGIPLAHRMLHLVLGS 181 AIGRDP+ WE+P SFKPERF+DS +DYKGQ+FELLPFG+GRRIC GIPLAHR+LH L S Sbjct: 84 AIGRDPDAWEDPLSFKPERFLDSNIDYKGQNFELLPFGSGRRICVGIPLAHRILHPALAS 143 Query: 182 MLHEFDWEVQDLEASGITDNRE 247 +LH FDWE+ D +E Sbjct: 144 LLHCFDWELGSNSTPETIDMKE 165 >ref|XP_002528653.1| cytochrome P450, putative [Ricinus communis] gi|223531942|gb|EEF33756.1| cytochrome P450, putative [Ricinus communis] Length = 515 Score = 121 bits (303), Expect = 7e-26 Identities = 52/69 (75%), Positives = 61/69 (88%) Frame = +2 Query: 2 AIGRDPEHWEEPFSFKPERFIDSKVDYKGQHFELLPFGAGRRICAGIPLAHRMLHLVLGS 181 AIGRDP+ WE+P SFKPERF+ S +DYKGQ+FELLPFG+GRRIC GIPLAHR+LHL L S Sbjct: 411 AIGRDPDAWEDPLSFKPERFLGSNIDYKGQNFELLPFGSGRRICVGIPLAHRVLHLALAS 470 Query: 182 MLHEFDWEV 208 +LH FDWE+ Sbjct: 471 LLHCFDWEL 479