BLASTX nr result
ID: Lithospermum22_contig00046813
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00046813 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002875738.1| proton-dependent oligopeptide transport fami... 79 3e-13 ref|XP_002532264.1| Peptide transporter, putative [Ricinus commu... 79 4e-13 ref|NP_190151.1| nitrate excretion transporter1 [Arabidopsis tha... 79 4e-13 dbj|BAC42313.1| putative transporter protein [Arabidopsis thaliana] 76 3e-12 dbj|BAJ34535.1| unnamed protein product [Thellungiella halophila] 76 3e-12 >ref|XP_002875738.1| proton-dependent oligopeptide transport family protein [Arabidopsis lyrata subsp. lyrata] gi|297321576|gb|EFH51997.1| proton-dependent oligopeptide transport family protein [Arabidopsis lyrata subsp. lyrata] Length = 558 Score = 79.3 bits (194), Expect = 3e-13 Identities = 37/62 (59%), Positives = 46/62 (74%) Frame = +1 Query: 100 SENTKGAQPKASRSRGGWITFPFIMATMAGLSLAAGGWVSNLIVYLIEEFNIKSIRAAKI 279 +E A RS GGWITFPF++ T+ GL++AA GW+ NLIVYLIEEFN+KSI AA+I Sbjct: 9 AETVISADSSTKRSGGGWITFPFMIVTLLGLTIAAWGWLLNLIVYLIEEFNVKSIAAAQI 68 Query: 280 YN 285 N Sbjct: 69 AN 70 >ref|XP_002532264.1| Peptide transporter, putative [Ricinus communis] gi|223528052|gb|EEF30130.1| Peptide transporter, putative [Ricinus communis] Length = 566 Score = 79.0 bits (193), Expect = 4e-13 Identities = 37/63 (58%), Positives = 50/63 (79%), Gaps = 1/63 (1%) Frame = +1 Query: 100 SENTKGAQPKAS-RSRGGWITFPFIMATMAGLSLAAGGWVSNLIVYLIEEFNIKSIRAAK 276 S + + P +S + RG WITFPFI+ TMAG++LA GG+++NLIVYLIEEFN KSI AA+ Sbjct: 6 SADPEAKMPSSSAKERGNWITFPFIIGTMAGVTLAGGGYLANLIVYLIEEFNFKSIDAAQ 65 Query: 277 IYN 285 ++N Sbjct: 66 VFN 68 >ref|NP_190151.1| nitrate excretion transporter1 [Arabidopsis thaliana] gi|75181815|sp|Q9M1E2.1|PTR37_ARATH RecName: Full=Nitrate excretion transporter 1 gi|6996268|emb|CAB75494.1| putative protein [Arabidopsis thaliana] gi|332644534|gb|AEE78055.1| nitrate excretion transporter1 [Arabidopsis thaliana] Length = 558 Score = 79.0 bits (193), Expect = 4e-13 Identities = 37/62 (59%), Positives = 46/62 (74%) Frame = +1 Query: 100 SENTKGAQPKASRSRGGWITFPFIMATMAGLSLAAGGWVSNLIVYLIEEFNIKSIRAAKI 279 +E A R GGWITFPF++AT+ GL++AA GW+ NLIVYLIEEFN+KSI AA+I Sbjct: 9 AETAISADSSTKRRGGGWITFPFMIATLLGLTIAAWGWLLNLIVYLIEEFNVKSIAAAQI 68 Query: 280 YN 285 N Sbjct: 69 AN 70 >dbj|BAC42313.1| putative transporter protein [Arabidopsis thaliana] Length = 558 Score = 76.3 bits (186), Expect = 3e-12 Identities = 35/48 (72%), Positives = 42/48 (87%) Frame = +1 Query: 142 RGGWITFPFIMATMAGLSLAAGGWVSNLIVYLIEEFNIKSIRAAKIYN 285 RGGWITFPF++AT+ GLS+ + GWV NLIV+LIEEFNIKSI AA+I N Sbjct: 21 RGGWITFPFMLATLLGLSVTSFGWVMNLIVFLIEEFNIKSIAAAQISN 68 >dbj|BAJ34535.1| unnamed protein product [Thellungiella halophila] Length = 552 Score = 76.3 bits (186), Expect = 3e-12 Identities = 35/51 (68%), Positives = 43/51 (84%) Frame = +1 Query: 133 SRSRGGWITFPFIMATMAGLSLAAGGWVSNLIVYLIEEFNIKSIRAAKIYN 285 S RGGWITFPF++AT+ GLS+ + GWV NLIV+LIEEFNIK+I AA+I N Sbjct: 14 SSKRGGWITFPFMIATLLGLSITSFGWVMNLIVFLIEEFNIKNIAAAQISN 64