BLASTX nr result
ID: Lithospermum22_contig00046796
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00046796 (322 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC27383.1| phytoene synthase [Helianthus annuus] 81 1e-13 gb|AAM45379.1| phytoene synthase [Tagetes erecta] 80 1e-13 gb|ABB52068.1| putative phytoene synthase [Daucus carota subsp. ... 79 3e-13 gb|ACO53104.1| phytoene synthase [Actinidia deliciosa] 79 3e-13 emb|CAC19567.1| phytoene synthase [Helianthus annuus] 79 4e-13 >emb|CAC27383.1| phytoene synthase [Helianthus annuus] Length = 414 Score = 80.9 bits (198), Expect = 1e-13 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -1 Query: 322 LYRQILDEIEANDYNNFTKRAYVSKPKKILALPAAYAKSLV 200 LYRQILDEIEANDYNNFTKRAYVSKPKKI+ALP AYAKSLV Sbjct: 364 LYRQILDEIEANDYNNFTKRAYVSKPKKIVALPVAYAKSLV 404 >gb|AAM45379.1| phytoene synthase [Tagetes erecta] Length = 399 Score = 80.5 bits (197), Expect = 1e-13 Identities = 39/41 (95%), Positives = 40/41 (97%) Frame = -1 Query: 322 LYRQILDEIEANDYNNFTKRAYVSKPKKILALPAAYAKSLV 200 LYRQILDEIEANDYNNFTKRAYVSKPKKI+ALP AYAKSLV Sbjct: 349 LYRQILDEIEANDYNNFTKRAYVSKPKKIVALPIAYAKSLV 389 >gb|ABB52068.1| putative phytoene synthase [Daucus carota subsp. sativus] Length = 438 Score = 79.3 bits (194), Expect = 3e-13 Identities = 38/43 (88%), Positives = 39/43 (90%) Frame = -1 Query: 322 LYRQILDEIEANDYNNFTKRAYVSKPKKILALPAAYAKSLVKT 194 LYRQILDEIEANDYNNFTKRAYVSKPKKILALP AYAK+ T Sbjct: 386 LYRQILDEIEANDYNNFTKRAYVSKPKKILALPVAYAKAFAPT 428 >gb|ACO53104.1| phytoene synthase [Actinidia deliciosa] Length = 437 Score = 79.3 bits (194), Expect = 3e-13 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -1 Query: 322 LYRQILDEIEANDYNNFTKRAYVSKPKKILALPAAYAKSLV 200 LYRQILDEIEANDYNNFT+RAYVSKPKK+LALP AYAKS+V Sbjct: 384 LYRQILDEIEANDYNNFTRRAYVSKPKKVLALPIAYAKSIV 424 >emb|CAC19567.1| phytoene synthase [Helianthus annuus] Length = 414 Score = 79.0 bits (193), Expect = 4e-13 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = -1 Query: 322 LYRQILDEIEANDYNNFTKRAYVSKPKKILALPAAYAKSLV 200 LYRQILDEIEANDYN+FTKRAYVSKPKKI+ALP AYAKSLV Sbjct: 364 LYRQILDEIEANDYNHFTKRAYVSKPKKIVALPVAYAKSLV 404