BLASTX nr result
ID: Lithospermum22_contig00046700
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00046700 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002326180.1| predicted protein [Populus trichocarpa] gi|2... 55 5e-06 >ref|XP_002326180.1| predicted protein [Populus trichocarpa] gi|222833373|gb|EEE71850.1| predicted protein [Populus trichocarpa] Length = 50 Score = 55.5 bits (132), Expect = 5e-06 Identities = 23/36 (63%), Positives = 29/36 (80%) Frame = -3 Query: 296 SWVEVAPSLITYPRKPSNKPELEPIIEDKNEGHDDE 189 SW+EVAP+ I YPRKPSN P LEPI E+ +E HD++ Sbjct: 10 SWIEVAPAPIIYPRKPSNAPRLEPIAEEGHEEHDED 45