BLASTX nr result
ID: Lithospermum22_contig00046637
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00046637 (203 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003535694.1| PREDICTED: pentatricopeptide repeat-containi... 65 4e-09 >ref|XP_003535694.1| PREDICTED: pentatricopeptide repeat-containing protein At3g12770-like [Glycine max] Length = 634 Score = 65.5 bits (158), Expect = 4e-09 Identities = 32/67 (47%), Positives = 41/67 (61%) Frame = -2 Query: 202 SEQGPYDTAFSIFKNLKNSIFSPNDLTFSFLLKACAKASNGPVYVNQIQTHVVKFGFIDD 23 ++ G + A S+F LK SPNDLTFSFL K C + + YV QI H+ K GF+ D Sbjct: 106 AQDGHFFHALSVFNYLKRRSLSPNDLTFSFLFKPCFRTKD-VRYVEQIHAHIQKIGFLSD 164 Query: 22 LYVCNGL 2 +VCNGL Sbjct: 165 PFVCNGL 171