BLASTX nr result
ID: Lithospermum22_contig00046527
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00046527 (406 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276086.2| PREDICTED: uncharacterized protein LOC100246... 66 3e-09 emb|CAN69469.1| hypothetical protein VITISV_042556 [Vitis vinifera] 66 3e-09 >ref|XP_002276086.2| PREDICTED: uncharacterized protein LOC100246362 [Vitis vinifera] Length = 403 Score = 65.9 bits (159), Expect = 3e-09 Identities = 42/70 (60%), Positives = 48/70 (68%), Gaps = 12/70 (17%) Frame = -2 Query: 174 TLLEAIYRSIDEG----------EETMRKKQQSKTGFKDEDE-MANFHRLQMIEKWMEKE 28 TLL+AIYRSIDEG ETMRKK + T K+EDE MA+ R MIEKWMEK+ Sbjct: 25 TLLDAIYRSIDEGGEGEEELVLYRETMRKKHSNCTVNKEEDEEMASLRRAIMIEKWMEKK 84 Query: 27 -SEKVVVRRQ 1 SEKVVVRR+ Sbjct: 85 VSEKVVVRRK 94 >emb|CAN69469.1| hypothetical protein VITISV_042556 [Vitis vinifera] Length = 403 Score = 65.9 bits (159), Expect = 3e-09 Identities = 42/70 (60%), Positives = 48/70 (68%), Gaps = 12/70 (17%) Frame = -2 Query: 174 TLLEAIYRSIDEG----------EETMRKKQQSKTGFKDEDE-MANFHRLQMIEKWMEKE 28 TLL+AIYRSIDEG ETMRKK + T K+EDE MA+ R MIEKWMEK+ Sbjct: 25 TLLDAIYRSIDEGGEGEEELVLYRETMRKKHSNCTVNKEEDEEMASLRRAIMIEKWMEKK 84 Query: 27 -SEKVVVRRQ 1 SEKVVVRR+ Sbjct: 85 VSEKVVVRRK 94