BLASTX nr result
ID: Lithospermum22_contig00046458
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00046458 (315 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300432.1| cationic amino acid transporter [Populus tri... 80 2e-13 ref|XP_002518795.1| cationic amino acid transporter, putative [R... 78 9e-13 ref|XP_003534865.1| PREDICTED: uncharacterized amino acid permea... 74 1e-11 ref|XP_003594855.1| High affinity cationic amino acid transporte... 73 3e-11 emb|CBI27231.3| unnamed protein product [Vitis vinifera] 72 6e-11 >ref|XP_002300432.1| cationic amino acid transporter [Populus trichocarpa] gi|222847690|gb|EEE85237.1| cationic amino acid transporter [Populus trichocarpa] Length = 577 Score = 79.7 bits (195), Expect = 2e-13 Identities = 39/64 (60%), Positives = 48/64 (75%) Frame = +1 Query: 124 MDSDQPPPKSYWRFSKNDFFPEPSFKNLNSYMSALSQTPRRLIDRVLDRSSDDFELVELK 303 MD P KSYWR SK DFFPEPSFK+L+SY +ALSQ RL DR+L RS++ ELV L+ Sbjct: 1 MDVQDSPRKSYWRCSKQDFFPEPSFKDLSSYRTALSQICPRLKDRLLSRSTETHELVTLR 60 Query: 304 KQSE 315 ++SE Sbjct: 61 RESE 64 >ref|XP_002518795.1| cationic amino acid transporter, putative [Ricinus communis] gi|223542176|gb|EEF43720.1| cationic amino acid transporter, putative [Ricinus communis] Length = 575 Score = 77.8 bits (190), Expect = 9e-13 Identities = 38/64 (59%), Positives = 48/64 (75%) Frame = +1 Query: 124 MDSDQPPPKSYWRFSKNDFFPEPSFKNLNSYMSALSQTPRRLIDRVLDRSSDDFELVELK 303 M+ P KSYWR+ K DFFPEP+F+NL++Y ALSQT RL DR+L RSS+ ELV L+ Sbjct: 1 MEFQDQPIKSYWRWRKQDFFPEPTFQNLSTYTCALSQTYPRLKDRLLSRSSETNELVTLQ 60 Query: 304 KQSE 315 K+SE Sbjct: 61 KESE 64 >ref|XP_003534865.1| PREDICTED: uncharacterized amino acid permease YfnA-like [Glycine max] Length = 585 Score = 73.9 bits (180), Expect = 1e-11 Identities = 38/69 (55%), Positives = 48/69 (69%), Gaps = 1/69 (1%) Frame = +1 Query: 112 LITTMDSDQPPP-KSYWRFSKNDFFPEPSFKNLNSYMSALSQTPRRLIDRVLDRSSDDFE 288 + +T D D+ P + YWR+SK DF PE SF++ N+Y+SALSQT R DR+L RS D E Sbjct: 1 MASTRDKDEAEPQRGYWRWSKQDFLPEESFQSWNNYVSALSQTRLRFKDRLLARSDDATE 60 Query: 289 LVELKKQSE 315 ELKKQSE Sbjct: 61 TEELKKQSE 69 >ref|XP_003594855.1| High affinity cationic amino acid transporter [Medicago truncatula] gi|355483903|gb|AES65106.1| High affinity cationic amino acid transporter [Medicago truncatula] Length = 578 Score = 72.8 bits (177), Expect = 3e-11 Identities = 38/61 (62%), Positives = 43/61 (70%) Frame = +1 Query: 133 DQPPPKSYWRFSKNDFFPEPSFKNLNSYMSALSQTPRRLIDRVLDRSSDDFELVELKKQS 312 D P KSYWR+SK DF PE SF++ N+Y+SALSQT R DRV RS D E ELKKQS Sbjct: 9 DCEPQKSYWRWSKQDFLPEESFQSWNNYVSALSQTWLRFKDRVQTRSDDATETHELKKQS 68 Query: 313 E 315 E Sbjct: 69 E 69 >emb|CBI27231.3| unnamed protein product [Vitis vinifera] Length = 702 Score = 71.6 bits (174), Expect = 6e-11 Identities = 35/61 (57%), Positives = 42/61 (68%) Frame = +1 Query: 133 DQPPPKSYWRFSKNDFFPEPSFKNLNSYMSALSQTPRRLIDRVLDRSSDDFELVELKKQS 312 D+ P+ YWR+SK DF PE SFKN SY SALSQT R DR+ RS D E+ E++KQS Sbjct: 124 DEIQPRGYWRWSKQDFLPEESFKNWASYRSALSQTCFRFKDRLTSRSEDAIEIGEMRKQS 183 Query: 313 E 315 E Sbjct: 184 E 184