BLASTX nr result
ID: Lithospermum22_contig00046448
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00046448 (276 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_358603.1| hypothetical protein PhapfoPp054 [Phalaenopsis ... 49 9e-10 >ref|YP_358603.1| hypothetical protein PhapfoPp054 [Phalaenopsis aphrodite subsp. formosana] gi|58802840|gb|AAW82560.1| hypothetical protein [Phalaenopsis aphrodite subsp. formosana] Length = 99 Score = 49.3 bits (116), Expect(2) = 9e-10 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 175 KKIVVGEVIVAKAIGIQILYIGKICFVINR 264 +KIVVG+VIVAKAIGI ILYIG+I FVINR Sbjct: 64 EKIVVGKVIVAKAIGIYILYIGRIRFVINR 93 Score = 38.5 bits (88), Expect(2) = 9e-10 Identities = 22/38 (57%), Positives = 27/38 (71%), Gaps = 3/38 (7%) Frame = +3 Query: 3 ELYKLPQ*H---KVKAPVYRKDLTV*EVTIKTTEPTIL 107 ELYK + K +APVYR+DLTV EV I+T +PTIL Sbjct: 8 ELYKFTRNFDEMKEEAPVYREDLTVSEVAIETRKPTIL 45