BLASTX nr result
ID: Lithospermum22_contig00046354
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00046354 (437 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588515.1| hypothetical protein MTR_1g008050 [Medicago ... 57 2e-06 >ref|XP_003588515.1| hypothetical protein MTR_1g008050 [Medicago truncatula] gi|355477563|gb|AES58766.1| hypothetical protein MTR_1g008050 [Medicago truncatula] Length = 1675 Score = 56.6 bits (135), Expect = 2e-06 Identities = 30/82 (36%), Positives = 47/82 (57%) Frame = +3 Query: 192 PRKREFPLLKMEDVDLVGMEKRFKFRVLLPNGKSVEVTFSRPQTRISMEELVNVLKQEYL 371 P+KR+ L+ +D D G+ K KF+VLLPNG SVE+ + + E V +++ YL Sbjct: 10 PKKRK--LVLNDDDDDTGIRKMRKFKVLLPNGTSVELKVLNTENAMHFGEFVGLIRTRYL 67 Query: 372 RVSKQSGFQTPKRGVNWKSSEL 437 +V +++ KR +NW S L Sbjct: 68 QVQRKNESMRKKREINWNSGGL 89