BLASTX nr result
ID: Lithospermum22_contig00046212
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00046212 (357 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI22750.3| unnamed protein product [Vitis vinifera] 57 1e-06 >emb|CBI22750.3| unnamed protein product [Vitis vinifera] Length = 1591 Score = 57.4 bits (137), Expect = 1e-06 Identities = 29/53 (54%), Positives = 38/53 (71%), Gaps = 2/53 (3%) Frame = +3 Query: 30 RFITPPFPFNKYGAILEYGGPLISSRLSTISPSAHG--CVLHFIKVDFQDSSV 182 R I+ FPFNK+G ILEYGG +SSR+STISP G C+ H +K+D +D S+ Sbjct: 694 RHISASFPFNKFGIILEYGGSHVSSRISTISPKLAGLPCLYH-LKMDLEDFSI 745