BLASTX nr result
ID: Lithospermum22_contig00046201
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00046201 (445 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN72989.1| hypothetical protein VITISV_031850 [Vitis vinifera] 55 5e-06 >emb|CAN72989.1| hypothetical protein VITISV_031850 [Vitis vinifera] Length = 161 Score = 55.5 bits (132), Expect = 5e-06 Identities = 29/58 (50%), Positives = 35/58 (60%) Frame = -2 Query: 378 HSPQRSFEGSSFPHEPHRSEALADCIEFIKKSATGEDNGREARIGGTAEGSDLVIPVP 205 HS R S +P+EPH SEA+ADCIEFIKKSA+ DN R + D +PVP Sbjct: 68 HSGSRDVPRSYYPNEPHHSEAVADCIEFIKKSASPGDN----RDSTASSSMDTAMPVP 121