BLASTX nr result
ID: Lithospermum22_contig00046149
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00046149 (280 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001031892.1| RNA-directed DNA polymerase (reverse transcr... 68 7e-10 ref|NP_567266.1| RNA-directed DNA polymerase (reverse transcript... 68 7e-10 gb|ABK28243.1| unknown [Arabidopsis thaliana] 68 7e-10 gb|ABE65512.1| hypothetical protein At4g04650 [Arabidopsis thali... 68 7e-10 ref|NP_178356.1| RNA-directed DNA polymerase (reverse transcript... 68 9e-10 >ref|NP_001031892.1| RNA-directed DNA polymerase (reverse transcriptase)-related family protein [Arabidopsis thaliana] gi|98962153|gb|ABF59406.1| unknown protein [Arabidopsis thaliana] gi|332004916|gb|AED92299.1| RNA-directed DNA polymerase (reverse transcriptase)-related family protein [Arabidopsis thaliana] Length = 209 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/67 (43%), Positives = 39/67 (58%), Gaps = 1/67 (1%) Frame = +3 Query: 9 KPPWAKLLWFKGHIPRYGFVGWVLCHNKLPTKDRFIRWGLVEERNCMFCEG-DEIISRLF 185 K W K +WFKG IP++ F+ WV ++LPT+D+ + WGL C+ C DE LF Sbjct: 141 KVDWHKAIWFKGRIPKHAFISWVNIRHRLPTRDKLLSWGLHVPSLCLLCNAFDETRQHLF 200 Query: 186 FDSRFLG 206 FD F G Sbjct: 201 FDCVFAG 207 >ref|NP_567266.1| RNA-directed DNA polymerase (reverse transcriptase)-related family protein [Arabidopsis thaliana] gi|5732057|gb|AAD48956.1|AF149414_5 contains similarity to a family of Arabidopsis thaliana predicted proteins, which have similarity to reverse transcriptases; see T14P8.10 (GB:AF069298) [Arabidopsis thaliana] gi|7267223|emb|CAB80830.1| AT4g04650 [Arabidopsis thaliana] gi|332657009|gb|AEE82409.1| RNA-directed DNA polymerase (reverse transcriptase)-related family protein [Arabidopsis thaliana] Length = 332 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/69 (42%), Positives = 42/69 (60%), Gaps = 2/69 (2%) Frame = +3 Query: 15 PWAKLLWFKGHIPRYGFVGWVLCHNKLPTKDRFIRWGLVEERNCMFCEG-DEIISRLFFD 191 PW K +WFK H+P++ F+ WV+ N+L T+DR WGL C+ C D+ + LFF+ Sbjct: 128 PWHKAVWFKNHVPKHAFICWVVAWNRLHTRDRLQNWGLSIPAECLLCNAHDDSRAHLFFE 187 Query: 192 SRFLG-NWR 215 +F G WR Sbjct: 188 CQFSGVVWR 196 >gb|ABK28243.1| unknown [Arabidopsis thaliana] Length = 297 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/69 (42%), Positives = 42/69 (60%), Gaps = 2/69 (2%) Frame = +3 Query: 15 PWAKLLWFKGHIPRYGFVGWVLCHNKLPTKDRFIRWGLVEERNCMFCEG-DEIISRLFFD 191 PW K +WFK H+P++ F+ WV+ N+L T+DR WGL C+ C D+ + LFF+ Sbjct: 128 PWHKAVWFKNHVPKHAFICWVVAWNRLHTRDRLQNWGLSIPAECLLCNAHDDSRAHLFFE 187 Query: 192 SRFLG-NWR 215 +F G WR Sbjct: 188 CQFSGVVWR 196 >gb|ABE65512.1| hypothetical protein At4g04650 [Arabidopsis thaliana] Length = 296 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/69 (42%), Positives = 42/69 (60%), Gaps = 2/69 (2%) Frame = +3 Query: 15 PWAKLLWFKGHIPRYGFVGWVLCHNKLPTKDRFIRWGLVEERNCMFCEG-DEIISRLFFD 191 PW K +WFK H+P++ F+ WV+ N+L T+DR WGL C+ C D+ + LFF+ Sbjct: 128 PWHKAVWFKNHVPKHAFICWVVAWNRLHTRDRLQNWGLSIPAECLLCNAHDDSRAHLFFE 187 Query: 192 SRFLG-NWR 215 +F G WR Sbjct: 188 CQFSGVVWR 196 >ref|NP_178356.1| RNA-directed DNA polymerase (reverse transcriptase)-related family protein [Arabidopsis thaliana] gi|3184287|gb|AAC18934.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis thaliana] gi|330250497|gb|AEC05591.1| RNA-directed DNA polymerase (reverse transcriptase)-related family protein [Arabidopsis thaliana] Length = 211 Score = 67.8 bits (164), Expect = 9e-10 Identities = 32/72 (44%), Positives = 42/72 (58%), Gaps = 1/72 (1%) Frame = +3 Query: 18 WAKLLWFKGHIPRYGFVGWVLCHNKLPTKDRFIRWGLVEERNCMFCE-GDEIISRLFFDS 194 W K +WFKG IP++ F+ WV ++L TKDR I WG + C+FC DE LFFD Sbjct: 43 WFKAIWFKGKIPKHAFIAWVNMRHRLHTKDRMISWGFIFPPLCLFCNTHDETRQHLFFDC 102 Query: 195 RFLGNWRKVLMY 230 F R+V +Y Sbjct: 103 EFA---REVWIY 111