BLASTX nr result
ID: Lithospermum22_contig00046014
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00046014 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_173420.1| hypothetical protein NitaMp078 [Nicotiana tabac... 89 4e-16 >ref|YP_173420.1| hypothetical protein NitaMp078 [Nicotiana tabacum] gi|56806583|dbj|BAD83484.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 122 Score = 89.0 bits (219), Expect = 4e-16 Identities = 45/54 (83%), Positives = 47/54 (87%), Gaps = 1/54 (1%) Frame = +2 Query: 2 GRAFFIGLVGGSHEIYAGRRNQMKVEGPFDSLRGIAKPSPGAIPRPSS-RPGRA 160 GRAFF+ +VGGSHEIYAGRRNQ KVEGPFDSLRGIA PSPGAI PSS R GRA Sbjct: 69 GRAFFVVIVGGSHEIYAGRRNQTKVEGPFDSLRGIAAPSPGAISGPSSRRAGRA 122