BLASTX nr result
ID: Lithospermum22_contig00045898
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00045898 (258 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003593126.1| Zinc finger MYM-type protein [Medicago trunc... 56 4e-06 ref|XP_003600098.1| Zinc finger MYM-type protein [Medicago trunc... 55 8e-06 >ref|XP_003593126.1| Zinc finger MYM-type protein [Medicago truncatula] gi|355482174|gb|AES63377.1| Zinc finger MYM-type protein [Medicago truncatula] Length = 754 Score = 55.8 bits (133), Expect = 4e-06 Identities = 26/51 (50%), Positives = 33/51 (64%) Frame = -3 Query: 190 GPHRFKFKEGTYPLKKDKTSLRFFGSWFSIFPSWLEYFPLTGATYCLPYFL 38 GP+++ ++ YPL +DK RF SWF IFPSWLEY P A YCL +L Sbjct: 117 GPYQWVAEK--YPLNEDKHPRRFQASWFKIFPSWLEYSPTNDAAYCLLCYL 165 >ref|XP_003600098.1| Zinc finger MYM-type protein [Medicago truncatula] gi|355489146|gb|AES70349.1| Zinc finger MYM-type protein [Medicago truncatula] Length = 795 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/51 (49%), Positives = 33/51 (64%) Frame = -3 Query: 190 GPHRFKFKEGTYPLKKDKTSLRFFGSWFSIFPSWLEYFPLTGATYCLPYFL 38 GP+++ ++ YPL +DK RF SWF +FPSWLEY P A YCL +L Sbjct: 84 GPYQWVAEK--YPLNEDKHPRRFQASWFKMFPSWLEYSPTNDAAYCLLCYL 132