BLASTX nr result
ID: Lithospermum22_contig00045850
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00045850 (225 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAF99785.1|AC012463_2 T2E6.4 [Arabidopsis thaliana] 56 3e-06 emb|CAB83148.1| putative protein [Arabidopsis thaliana] 55 6e-06 gb|AAG51098.1|AC025295_6 hypothetical protein [Arabidopsis thali... 55 8e-06 >gb|AAF99785.1|AC012463_2 T2E6.4 [Arabidopsis thaliana] Length = 740 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/66 (40%), Positives = 40/66 (60%) Frame = +3 Query: 6 SWVWRKMLRLGDDIRAHVKVQIGSGCESSFLYDNWHQLGPLYKVLNDRKISLTRVQKNDT 185 SW+W+K+L+ D ++ KV+I SG +SF YDNW QLG L V N R+ + T Sbjct: 500 SWMWKKLLKYRDVAKSMCKVEIKSGSSTSFWYDNWSQLGQLVDVTNARRTIDMGIPLAAT 559 Query: 186 IAEVVS 203 +A V++ Sbjct: 560 VATVLA 565 >emb|CAB83148.1| putative protein [Arabidopsis thaliana] Length = 280 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/63 (34%), Positives = 39/63 (61%) Frame = +3 Query: 6 SWVWRKMLRLGDDIRAHVKVQIGSGCESSFLYDNWHQLGPLYKVLNDRKISLTRVQKNDT 185 SW+WRK+++ D + KV++G+G +SF +D+W LG LY + DR + + + T Sbjct: 75 SWIWRKLIKFRDAAKTLCKVEVGNGELASFWFDSWSPLGRLYDIAGDRGVIDMGINRQMT 134 Query: 186 IAE 194 +A+ Sbjct: 135 VAD 137 >gb|AAG51098.1|AC025295_6 hypothetical protein [Arabidopsis thaliana] Length = 504 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/63 (39%), Positives = 37/63 (58%) Frame = +3 Query: 6 SWVWRKMLRLGDDIRAHVKVQIGSGCESSFLYDNWHQLGPLYKVLNDRKISLTRVQKNDT 185 SW+WRK+L+ D R KV+I +G ++SF YD+W LG L + DR + K+ T Sbjct: 257 SWMWRKILKFRDIARTLCKVEINNGAQTSFWYDDWSDLGRLIESAGDRGAIDLGINKHAT 316 Query: 186 IAE 194 + E Sbjct: 317 VVE 319