BLASTX nr result
ID: Lithospermum22_contig00045732
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00045732 (314 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002313438.1| predicted protein [Populus trichocarpa] gi|2... 62 4e-08 ref|XP_002533586.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 ref|XP_002298360.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 >ref|XP_002313438.1| predicted protein [Populus trichocarpa] gi|222849846|gb|EEE87393.1| predicted protein [Populus trichocarpa] Length = 203 Score = 62.4 bits (150), Expect = 4e-08 Identities = 39/75 (52%), Positives = 50/75 (66%), Gaps = 2/75 (2%) Frame = -1 Query: 314 IQLIF--PPTPKKAKTLPSAKRKRCNSKRMLLLDCSKQIEAVFPLPDFLADLGGKIKKVR 141 I +IF PP P+K K+LPSAKRK + +R +LLD S +IE++FP P DLGGKIKKVR Sbjct: 98 IPVIFQCPPAPRKPKSLPSAKRK--SPQRRVLLDLSNEIESLFP-PALAGDLGGKIKKVR 154 Query: 140 ANLA*NDKNYLYTTK 96 ND N + T+ Sbjct: 155 QG---NDTNKVKQTQ 166 >ref|XP_002533586.1| conserved hypothetical protein [Ricinus communis] gi|223526530|gb|EEF28791.1| conserved hypothetical protein [Ricinus communis] Length = 176 Score = 57.0 bits (136), Expect = 2e-06 Identities = 31/53 (58%), Positives = 39/53 (73%) Frame = -1 Query: 299 PPTPKKAKTLPSAKRKRCNSKRMLLLDCSKQIEAVFPLPDFLADLGGKIKKVR 141 PP P+K K+LPS KRK ++R +LLD S +IE++FP P ADLG KIKKVR Sbjct: 115 PPAPRKPKSLPSNKRK-SPARRRVLLDLSNEIESLFP-PALRADLGAKIKKVR 165 >ref|XP_002298360.1| predicted protein [Populus trichocarpa] gi|222845618|gb|EEE83165.1| predicted protein [Populus trichocarpa] Length = 168 Score = 56.6 bits (135), Expect = 2e-06 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 2/60 (3%) Frame = -1 Query: 314 IQLIF--PPTPKKAKTLPSAKRKRCNSKRMLLLDCSKQIEAVFPLPDFLADLGGKIKKVR 141 I +IF PP P K K+LPS KRK + +R +LLD S ++E +FP P A+LGGKIKKVR Sbjct: 105 IPVIFQCPPAPIKPKSLPSTKRK--SPRRRVLLDLSNEVETLFP-PALAANLGGKIKKVR 161