BLASTX nr result
ID: Lithospermum22_contig00045663
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00045663 (396 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001152105.1| ORF66a [Pinus koraiensis] gi|145048732|gb|AB... 55 6e-06 >ref|YP_001152105.1| ORF66a [Pinus koraiensis] gi|145048732|gb|ABP35351.1| ORF66a [Pinus koraiensis] Length = 66 Score = 55.1 bits (131), Expect = 6e-06 Identities = 33/62 (53%), Positives = 38/62 (61%), Gaps = 3/62 (4%) Frame = -1 Query: 330 RGVAQLGSAFVLGTKCHRFKSCHPYLLLFKRQIEKRAVTRDLLRSIQN*R---ESFSLWS 160 R VAQLGS FVLGTKC RFKSCHPYL L + T+D L SI+ ES+ + Sbjct: 4 RDVAQLGSVFVLGTKCRRFKSCHPYLSLL---FYGKKGTKDHLISIRREHQIIESYQMRK 60 Query: 159 YL 154 YL Sbjct: 61 YL 62