BLASTX nr result
ID: Lithospermum22_contig00045632
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00045632 (302 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002869021.1| hypothetical protein ARALYDRAFT_490952 [Arab... 61 1e-09 ref|NP_195399.1| geranylgeranyl pyrophosphate synthase 11 [Arabi... 61 2e-09 gb|AAM65107.1| geranylgeranyl pyrophosphate synthase [Arabidopsi... 61 2e-09 ref|XP_003629488.1| Geranylgeranyl pyrophosphate synthase [Medic... 60 2e-08 gb|AAA32797.1| geranylgeranyl pyrophosphate synthase [Arabidopsi... 59 2e-08 >ref|XP_002869021.1| hypothetical protein ARALYDRAFT_490952 [Arabidopsis lyrata subsp. lyrata] gi|297314857|gb|EFH45280.1| hypothetical protein ARALYDRAFT_490952 [Arabidopsis lyrata subsp. lyrata] Length = 379 Score = 61.2 bits (147), Expect(2) = 1e-09 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 3/55 (5%) Frame = +3 Query: 6 QNEEKALDEEAMLREPLKMHESMRYSLLGGGKSLRPIGCL*A---VGRQESVVMP 161 ++ KALD LREPLK+HE+MRYSLL GGK +RP+ C+ A VG +ES MP Sbjct: 93 ESVNKALDSAVPLREPLKIHEAMRYSLLAGGKRVRPVLCIAACELVGGEESTAMP 147 Score = 26.2 bits (56), Expect(2) = 1e-09 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 4/35 (11%) Frame = +1 Query: 172 KLFGEDSAVLAGTS----AGEKSVDKDSGKVTSPI 264 K+FGED AVLAG + A E S V SP+ Sbjct: 182 KVFGEDVAVLAGDALLSFAFEHLASATSSDVVSPV 216 >ref|NP_195399.1| geranylgeranyl pyrophosphate synthase 11 [Arabidopsis thaliana] gi|13432144|sp|P34802.2|GGPP1_ARATH RecName: Full=Heterodimeric geranylgeranyl pyrophosphate synthase large subunit 1, chloroplastic; Short=GGPP synthase 1; Short=GGPS1; AltName: Full=(2E,6E)-farnesyl diphosphate synthase 1; AltName: Full=Dimethylallyltranstransferase 1; AltName: Full=Farnesyl diphosphate synthase 1; AltName: Full=Farnesyltranstransferase 1; AltName: Full=Geranyltranstransferase 1; Flags: Precursor gi|2464899|emb|CAB16803.1| geranylgeranyl pyrophosphate synthase [Arabidopsis thaliana] gi|7270630|emb|CAB80347.1| geranylgeranyl pyrophosphate synthase [Arabidopsis thaliana] gi|110742524|dbj|BAE99179.1| geranylgeranyl pyrophosphate synthase [Arabidopsis thaliana] gi|332661305|gb|AEE86705.1| geranylgeranyl pyrophosphate synthase 11 [Arabidopsis thaliana] Length = 371 Score = 60.8 bits (146), Expect(2) = 2e-09 Identities = 31/51 (60%), Positives = 37/51 (72%), Gaps = 3/51 (5%) Frame = +3 Query: 18 KALDEEAMLREPLKMHESMRYSLLGGGKSLRPIGCL*A---VGRQESVVMP 161 KALD LREPLK+HE+MRYSLL GGK +RP+ C+ A VG +ES MP Sbjct: 89 KALDSAVPLREPLKIHEAMRYSLLAGGKRVRPVLCIAACELVGGEESTAMP 139 Score = 26.2 bits (56), Expect(2) = 2e-09 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 4/35 (11%) Frame = +1 Query: 172 KLFGEDSAVLAGTS----AGEKSVDKDSGKVTSPI 264 K+FGED AVLAG + A E S V SP+ Sbjct: 174 KVFGEDVAVLAGDALLSFAFEHLASATSSDVVSPV 208 >gb|AAM65107.1| geranylgeranyl pyrophosphate synthase [Arabidopsis thaliana] Length = 371 Score = 60.8 bits (146), Expect(2) = 2e-09 Identities = 31/51 (60%), Positives = 37/51 (72%), Gaps = 3/51 (5%) Frame = +3 Query: 18 KALDEEAMLREPLKMHESMRYSLLGGGKSLRPIGCL*A---VGRQESVVMP 161 KALD LREPLK+HE+MRYSLL GGK +RP+ C+ A VG +ES MP Sbjct: 89 KALDSAVPLREPLKIHEAMRYSLLAGGKRVRPVLCIAACELVGGEESTAMP 139 Score = 26.2 bits (56), Expect(2) = 2e-09 Identities = 16/35 (45%), Positives = 19/35 (54%), Gaps = 4/35 (11%) Frame = +1 Query: 172 KLFGEDSAVLAGTS----AGEKSVDKDSGKVTSPI 264 K+FGED AVLAG + A E S V SP+ Sbjct: 174 KVFGEDVAVLAGDALLSFAFEHLASATSSDVVSPV 208 >ref|XP_003629488.1| Geranylgeranyl pyrophosphate synthase [Medicago truncatula] gi|295322741|gb|ADG01842.1| geranylgeranyl-diphosphate synthase [Medicago truncatula] gi|355523510|gb|AET03964.1| Geranylgeranyl pyrophosphate synthase [Medicago truncatula] Length = 372 Score = 60.1 bits (144), Expect(2) = 2e-08 Identities = 31/51 (60%), Positives = 37/51 (72%), Gaps = 3/51 (5%) Frame = +3 Query: 18 KALDEEAMLREPLKMHESMRYSLLGGGKSLRPIGCL*A---VGRQESVVMP 161 KALD+ LREPLK+HE+MRYSLL GGK +RP+ CL A VG E + MP Sbjct: 94 KALDDAVSLREPLKVHEAMRYSLLAGGKRVRPVLCLAACELVGGTEPMAMP 144 Score = 23.5 bits (49), Expect(2) = 2e-08 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 172 KLFGEDSAVLAG 207 K+FGED AVLAG Sbjct: 179 KVFGEDVAVLAG 190 >gb|AAA32797.1| geranylgeranyl pyrophosphate synthase [Arabidopsis thaliana] Length = 371 Score = 58.5 bits (140), Expect(2) = 2e-08 Identities = 30/51 (58%), Positives = 36/51 (70%), Gaps = 3/51 (5%) Frame = +3 Query: 18 KALDEEAMLREPLKMHESMRYSLLGGGKSLRPIGCL*A---VGRQESVVMP 161 KALD LREPLK+HE+M YSLL GGK +RP+ C+ A VG +ES MP Sbjct: 89 KALDSAVPLREPLKIHEAMSYSLLAGGKRVRPVLCIAACELVGGEESTAMP 139 Score = 25.0 bits (53), Expect(2) = 2e-08 Identities = 15/35 (42%), Positives = 19/35 (54%), Gaps = 4/35 (11%) Frame = +1 Query: 172 KLFGEDSAVLAGTS----AGEKSVDKDSGKVTSPI 264 K+FGED AVLAG + + E S V SP+ Sbjct: 174 KVFGEDVAVLAGDALLSFSFEHLASATSSDVVSPV 208