BLASTX nr result
ID: Lithospermum22_contig00045592
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00045592 (295 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABD96948.1| hypothetical protein [Cleome spinosa] 47 6e-07 >gb|ABD96948.1| hypothetical protein [Cleome spinosa] Length = 539 Score = 47.0 bits (110), Expect(2) = 6e-07 Identities = 26/65 (40%), Positives = 39/65 (60%) Frame = +3 Query: 93 KILGVSLSSRSLTSEDYGALISKIYGKING**SRHLSLGGRAELIRSSIFGV*NF*CINL 272 + LGVSLS LT DY L+ ++ KIN +R+LS GR +L+ + I+G+ N + Sbjct: 217 RYLGVSLSPVRLTKSDYQPLLDRVKAKINSWTTRYLSYAGRLQLVGTVIYGMVNAWGMIF 276 Query: 273 PLPKY 287 LPK+ Sbjct: 277 MLPKF 281 Score = 31.2 bits (69), Expect(2) = 6e-07 Identities = 14/34 (41%), Positives = 19/34 (55%) Frame = +1 Query: 4 KSRIYFGSTPGFVRA*LCEFIGMSEGVLPIRYLG 105 K+ I+ G + LC IG + G LP+RYLG Sbjct: 187 KTEIFLRGLNGTEASTLCAVIGFTRGYLPVRYLG 220