BLASTX nr result
ID: Lithospermum22_contig00045591
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00045591 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67511.1| hypothetical protein VITISV_026953 [Vitis vinifera] 55 8e-06 >emb|CAN67511.1| hypothetical protein VITISV_026953 [Vitis vinifera] Length = 335 Score = 54.7 bits (130), Expect = 8e-06 Identities = 30/54 (55%), Positives = 36/54 (66%), Gaps = 4/54 (7%) Frame = -1 Query: 273 VDRHFIKGKLSKSTM*IR----GQQLADISTKNIPEKAFNHLLSKLGLIDIYRQ 124 VDRHFI KL K + I+ Q++ADI TK +P AF+ L SKLGLIDIY Q Sbjct: 281 VDRHFITEKLEKGVISIKYIPTDQEVADIFTKGLPRPAFDFLTSKLGLIDIYSQ 334