BLASTX nr result
ID: Lithospermum22_contig00045471
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00045471 (217 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002271106.2| PREDICTED: uncharacterized protein LOC100265... 56 3e-06 emb|CBI37336.3| unnamed protein product [Vitis vinifera] 56 3e-06 >ref|XP_002271106.2| PREDICTED: uncharacterized protein LOC100265430 [Vitis vinifera] Length = 597 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/46 (58%), Positives = 36/46 (78%) Frame = +1 Query: 19 EILLAQEDEKWKRSDVETSEDEKKRAPSRSLRKKAINASSRLSHTI 156 EI+ EDEK +RSD ETSEDE+ R RSL+KKA++AS+R +HT+ Sbjct: 4 EIVAVAEDEKGRRSDPETSEDERPRRRIRSLKKKAMSASTRFTHTL 49 >emb|CBI37336.3| unnamed protein product [Vitis vinifera] Length = 611 Score = 56.2 bits (134), Expect = 3e-06 Identities = 27/46 (58%), Positives = 36/46 (78%) Frame = +1 Query: 19 EILLAQEDEKWKRSDVETSEDEKKRAPSRSLRKKAINASSRLSHTI 156 EI+ EDEK +RSD ETSEDE+ R RSL+KKA++AS+R +HT+ Sbjct: 18 EIVAVAEDEKGRRSDPETSEDERPRRRIRSLKKKAMSASTRFTHTL 63