BLASTX nr result
ID: Lithospermum22_contig00045388
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00045388 (313 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277540.1| PREDICTED: respiratory burst oxidase homolog... 67 1e-09 ref|XP_002516222.1| respiratory burst oxidase, putative [Ricinus... 65 4e-09 gb|AAC39478.1| respiratory burst oxidase protein E [Arabidopsis ... 64 1e-08 ref|NP_173357.1| riboflavin synthase-like protein [Arabidopsis t... 64 1e-08 sp|O81211.2|RBOHE_ARATH RecName: Full=Respiratory burst oxidase ... 64 1e-08 >ref|XP_002277540.1| PREDICTED: respiratory burst oxidase homolog protein E [Vitis vinifera] gi|297738517|emb|CBI27762.3| unnamed protein product [Vitis vinifera] Length = 917 Score = 67.0 bits (162), Expect = 1e-09 Identities = 31/40 (77%), Positives = 33/40 (82%) Frame = +1 Query: 7 TWTYIGVPLLLYVAERSLRTCRSEHYSVKILKVQLLSSLI 126 TW YI VP LLYVAERSLRTCRSEHYSVKILKV +L + Sbjct: 567 TWMYISVPFLLYVAERSLRTCRSEHYSVKILKVSVLPGAV 606 >ref|XP_002516222.1| respiratory burst oxidase, putative [Ricinus communis] gi|223544708|gb|EEF46224.1| respiratory burst oxidase, putative [Ricinus communis] Length = 934 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 7 TWTYIGVPLLLYVAERSLRTCRSEHYSVKILKVQLL 114 TW YI PLLLYVAERS+RTCRSEHYSVKILKV +L Sbjct: 585 TWLYISAPLLLYVAERSVRTCRSEHYSVKILKVSVL 620 >gb|AAC39478.1| respiratory burst oxidase protein E [Arabidopsis thaliana] Length = 948 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +1 Query: 7 TWTYIGVPLLLYVAERSLRTCRSEHYSVKILKVQLL 114 TW YI VPL+LYVAERSLR CRS+HYSVKILKV +L Sbjct: 600 TWMYISVPLVLYVAERSLRACRSKHYSVKILKVSML 635 >ref|NP_173357.1| riboflavin synthase-like protein [Arabidopsis thaliana] gi|332191699|gb|AEE29820.1| riboflavin synthase-like protein [Arabidopsis thaliana] Length = 926 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +1 Query: 7 TWTYIGVPLLLYVAERSLRTCRSEHYSVKILKVQLL 114 TW YI VPL+LYVAERSLR CRS+HYSVKILKV +L Sbjct: 578 TWMYISVPLVLYVAERSLRACRSKHYSVKILKVSML 613 >sp|O81211.2|RBOHE_ARATH RecName: Full=Respiratory burst oxidase homolog protein E; AltName: Full=NADPH oxidase RBOHE; Short=AtRBOHE Length = 952 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = +1 Query: 7 TWTYIGVPLLLYVAERSLRTCRSEHYSVKILKVQLL 114 TW YI VPL+LYVAERSLR CRS+HYSVKILKV +L Sbjct: 604 TWMYISVPLVLYVAERSLRACRSKHYSVKILKVSML 639