BLASTX nr result
ID: Lithospermum22_contig00045383
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00045383 (311 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA66019.1| hypothetical protein [Beta vulgaris subsp. vulga... 61 8e-08 >emb|CCA66019.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 859 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/86 (33%), Positives = 51/86 (59%), Gaps = 1/86 (1%) Frame = +2 Query: 8 FTAARVQAYVDTYWFLRGGVQVEKRGTIFTFRFENMDDKDEVI-LRSPLNINGALLLLCH 184 F+ +Q++VD+ W RG ++V K G +F F +M D+ +++ L +N NGALL+L Sbjct: 49 FSVRHIQSWVDS-WVTRGRIKVTKEGDLFFFHSRDMQDRFDILGLYDTMNFNGALLVLKP 107 Query: 185 WTPNLCFQNLTIPTVELWLQIHGIPV 262 W P F++ +W+++ GIP+ Sbjct: 108 WKPLDSFKSFNFSESAIWVRLEGIPL 133