BLASTX nr result
ID: Lithospermum22_contig00045353
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00045353 (235 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003553707.1| PREDICTED: uncharacterized protein LOC100797... 56 3e-06 ref|XP_003520793.1| PREDICTED: uncharacterized protein LOC100815... 55 6e-06 >ref|XP_003553707.1| PREDICTED: uncharacterized protein LOC100797967 [Glycine max] Length = 326 Score = 56.2 bits (134), Expect = 3e-06 Identities = 35/78 (44%), Positives = 47/78 (60%) Frame = +1 Query: 1 SEGSNNNNGHKFWNNLSFSHVHKDKKVGKMEKSREKLKIPKMKKKGENGVMGKRRMAPMQ 180 SEG +NN KFW+ +SFS KDKK +K K K+ K NG+ GK+R+ P Sbjct: 218 SEGRSNN---KFWSTISFSPAAKDKKPQNQGNGPQKPK--KVAGKPTNGI-GKKRV-PAA 270 Query: 181 STHEMHYISKRAQDEEMK 234 S HE+HY + RAQ EE++ Sbjct: 271 SPHELHYKANRAQAEELR 288 >ref|XP_003520793.1| PREDICTED: uncharacterized protein LOC100815893 [Glycine max] Length = 319 Score = 55.1 bits (131), Expect = 6e-06 Identities = 35/78 (44%), Positives = 47/78 (60%) Frame = +1 Query: 1 SEGSNNNNGHKFWNNLSFSHVHKDKKVGKMEKSREKLKIPKMKKKGENGVMGKRRMAPMQ 180 SEG +NN KFW+ +SFS K+KK +K + K+ K NGV GKRR+ P Sbjct: 215 SEGRSNN---KFWSTISFSPAAKEKKGNGPQKPK------KVAGKPTNGV-GKRRV-PAS 263 Query: 181 STHEMHYISKRAQDEEMK 234 S HE+HY + RAQ EE++ Sbjct: 264 SPHELHYKANRAQAEELR 281