BLASTX nr result
ID: Lithospermum22_contig00045182
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00045182 (304 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAR28757.1| anthocyanin 3-O-glucoside-6''-O-hydroxycinnamoylt... 70 2e-10 gb|AAR26386.1| putative acyltransferase [Salvia splendens] 70 2e-10 gb|AAR13301.1| anthocyanin acyltransferase [Phaseolus vulgaris] 70 2e-10 sp|Q8W1W9.1|5MAT1_SALSN RecName: Full=Malonyl-coenzyme:anthocyan... 70 2e-10 ref|XP_002326110.1| predicted protein [Populus trichocarpa] gi|2... 69 5e-10 >gb|AAR28757.1| anthocyanin 3-O-glucoside-6''-O-hydroxycinnamoyltransferase [Salvia splendens] Length = 455 Score = 70.1 bits (170), Expect = 2e-10 Identities = 31/59 (52%), Positives = 40/59 (67%) Frame = +2 Query: 125 PPGSVPDLSIPLTCSDMSWIGLSPVQRLIFYHHPISTTFFLDAIIPGLKNSLSSALKHF 301 PPGSVPD ++PLT D++W+ P+ +LIFY P S FL ++P LK SLS LKHF Sbjct: 14 PPGSVPDQTLPLTFFDINWLHFHPMLQLIFYEFPCSNPHFLQTVVPKLKQSLSLTLKHF 72 >gb|AAR26386.1| putative acyltransferase [Salvia splendens] Length = 459 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/60 (50%), Positives = 41/60 (68%) Frame = +2 Query: 125 PPGSVPDLSIPLTCSDMSWIGLSPVQRLIFYHHPISTTFFLDAIIPGLKNSLSSALKHFP 304 PPGS DL++PL D+ W+ P++RLIFY+HP + F I+P LK+SLS L+HFP Sbjct: 14 PPGSAADLTLPLCFFDIIWLHFHPIRRLIFYNHPCTEAEFSSTIVPNLKHSLSLTLQHFP 73 >gb|AAR13301.1| anthocyanin acyltransferase [Phaseolus vulgaris] Length = 467 Score = 70.1 bits (170), Expect = 2e-10 Identities = 31/59 (52%), Positives = 40/59 (67%) Frame = +2 Query: 125 PPGSVPDLSIPLTCSDMSWIGLSPVQRLIFYHHPISTTFFLDAIIPGLKNSLSSALKHF 301 PPGSVP SIPLT D+ W+ P++R+ FY+ P ST F ++P LKNSLS L+HF Sbjct: 16 PPGSVPSTSIPLTFFDLPWLCCPPLKRIFFYNFPYSTQHFFQTLLPTLKNSLSLTLQHF 74 >sp|Q8W1W9.1|5MAT1_SALSN RecName: Full=Malonyl-coenzyme:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase; Short=Malonyl CoA:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase; Short=Ss5MaT1 gi|17980234|gb|AAL50566.1|AF405707_1 malonyl CoA:anthocyanin 5-O-glucoside-6'''-O-malonyltransferase [Salvia splendens] Length = 462 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/59 (54%), Positives = 41/59 (69%) Frame = +2 Query: 125 PPGSVPDLSIPLTCSDMSWIGLSPVQRLIFYHHPISTTFFLDAIIPGLKNSLSSALKHF 301 PP + DLSIPL+ D+ W+ PV+RL+FYHHP S + FL I+P LK SLS AL H+ Sbjct: 15 PPPAANDLSIPLSFFDIKWLHYHPVRRLLFYHHPSSKSQFLHTIVPHLKQSLSLALTHY 73 >ref|XP_002326110.1| predicted protein [Populus trichocarpa] gi|222862985|gb|EEF00492.1| predicted protein [Populus trichocarpa] Length = 466 Score = 68.6 bits (166), Expect = 5e-10 Identities = 32/59 (54%), Positives = 39/59 (66%) Frame = +2 Query: 125 PPGSVPDLSIPLTCSDMSWIGLSPVQRLIFYHHPISTTFFLDAIIPGLKNSLSSALKHF 301 PPGSVP S+PLT D W P++RL FY P T +F+ I+P LKNSLS AL+HF Sbjct: 18 PPGSVPTTSLPLTFFDFPWHLCPPMERLFFYELPYPTLYFMHKILPSLKNSLSLALQHF 76