BLASTX nr result
ID: Lithospermum22_contig00044992
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00044992 (340 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528523.1| conserved hypothetical protein [Ricinus comm... 58 7e-07 >ref|XP_002528523.1| conserved hypothetical protein [Ricinus communis] gi|223532025|gb|EEF33835.1| conserved hypothetical protein [Ricinus communis] Length = 127 Score = 58.2 bits (139), Expect = 7e-07 Identities = 37/87 (42%), Positives = 58/87 (66%), Gaps = 6/87 (6%) Frame = +3 Query: 54 MSHM---NYSKISKKNNGIS-RGFKLNIKKFSIQSLRAKFVFMFNKFFSKRLRFFSYGGL 221 MSH+ +YSKI ++ +G RGF+LN K+FS+Q LRA+FV++F K S+ SYG Sbjct: 1 MSHVMMGSYSKIGRRYHGYGGRGFRLNCKRFSVQRLRARFVYLF-KLLSRWKS--SYGHA 57 Query: 222 LQSMRNMGSKRS--KENYGSKRNLIMK 296 +QS++ S+ S K N S+R+L+++ Sbjct: 58 VQSLKRSMSRSSGIKRNTSSRRSLVVE 84