BLASTX nr result
ID: Lithospermum22_contig00044983
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00044983 (311 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273974.2| PREDICTED: ethylene-responsive transcription... 63 2e-08 ref|XP_003530164.1| PREDICTED: ethylene-responsive transcription... 63 2e-08 ref|XP_003521085.1| PREDICTED: ethylene-responsive transcription... 63 2e-08 emb|CBI16632.3| unnamed protein product [Vitis vinifera] 63 2e-08 gb|ACU24100.1| unknown [Glycine max] 63 2e-08 >ref|XP_002273974.2| PREDICTED: ethylene-responsive transcription factor ERF034-like [Vitis vinifera] Length = 227 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -1 Query: 107 DKGGKQHNPVYRGVRMRTWGKWVSEIREPKKKSRI 3 + GKQH P YRGVRMR WGKWVSEIREPKKKSRI Sbjct: 53 ENDGKQH-PTYRGVRMRNWGKWVSEIREPKKKSRI 86 >ref|XP_003530164.1| PREDICTED: ethylene-responsive transcription factor ERF034-like [Glycine max] Length = 363 Score = 63.2 bits (152), Expect = 2e-08 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -1 Query: 107 DKGGKQHNPVYRGVRMRTWGKWVSEIREPKKKSRI 3 D + H+P YRGVRMR WGKWVSEIREP+KKSRI Sbjct: 181 DNSNQNHHPTYRGVRMRNWGKWVSEIREPRKKSRI 215 >ref|XP_003521085.1| PREDICTED: ethylene-responsive transcription factor ERF034-like [Glycine max] Length = 287 Score = 63.2 bits (152), Expect = 2e-08 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -1 Query: 107 DKGGKQHNPVYRGVRMRTWGKWVSEIREPKKKSRI 3 D + H+P YRGVRMR WGKWVSEIREP+KKSRI Sbjct: 105 DNSNQNHHPTYRGVRMRNWGKWVSEIREPRKKSRI 139 >emb|CBI16632.3| unnamed protein product [Vitis vinifera] Length = 692 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -1 Query: 107 DKGGKQHNPVYRGVRMRTWGKWVSEIREPKKKSRI 3 + GKQH P YRGVRMR WGKWVSEIREPKKKSRI Sbjct: 546 ENDGKQH-PTYRGVRMRNWGKWVSEIREPKKKSRI 579 >gb|ACU24100.1| unknown [Glycine max] Length = 287 Score = 63.2 bits (152), Expect = 2e-08 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -1 Query: 107 DKGGKQHNPVYRGVRMRTWGKWVSEIREPKKKSRI 3 D + H+P YRGVRMR WGKWVSEIREP+KKSRI Sbjct: 105 DNSNQNHHPTYRGVRMRNWGKWVSEIREPRKKSRI 139