BLASTX nr result
ID: Lithospermum22_contig00044961
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00044961 (569 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN69404.1| hypothetical protein VITISV_012227 [Vitis vinifera] 55 6e-06 >emb|CAN69404.1| hypothetical protein VITISV_012227 [Vitis vinifera] Length = 530 Score = 55.5 bits (132), Expect = 6e-06 Identities = 22/67 (32%), Positives = 39/67 (58%) Frame = +1 Query: 169 VSMKKVVARSNGIKFTVDFNIDGQLIGPNNSTFVEYIGLLARSMIPLTDNNWYRTDGVVK 348 ++ K ++ +S GIK V +N+DG IG + Y+G LAR+M+P+ W+ +K Sbjct: 17 MTRKSMITKSKGIKLQVKYNLDGIFIGESXVHLTSYLGXLARTMVPIRYQTWHVVPKQLK 76 Query: 349 QKIWEEL 369 K+W+ + Sbjct: 77 DKLWDSI 83