BLASTX nr result
ID: Lithospermum22_contig00044924
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00044924 (355 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306314.1| predicted protein [Populus trichocarpa] gi|2... 60 2e-07 >ref|XP_002306314.1| predicted protein [Populus trichocarpa] gi|222855763|gb|EEE93310.1| predicted protein [Populus trichocarpa] Length = 573 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/51 (52%), Positives = 34/51 (66%) Frame = +3 Query: 201 DMEDETPERRSTGCGLFGTIFRGKNTWPRRSTSTGSIPHTNPNNLPRHTST 353 +M D +PE++ GCGLF +F ++ WPRRSTSTGSIP N N R ST Sbjct: 3 NMGDISPEKKPAGCGLFSVVFGRRSFWPRRSTSTGSIPTVNAANFTRTPST 53