BLASTX nr result
ID: Lithospermum22_contig00044874
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00044874 (259 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514810.1| ATP binding protein, putative [Ricinus commu... 59 5e-07 gb|AFD22619.1| dicer-like 2 protein [Nicotiana attenuata] 57 1e-06 >ref|XP_002514810.1| ATP binding protein, putative [Ricinus communis] gi|223545861|gb|EEF47364.1| ATP binding protein, putative [Ricinus communis] Length = 1388 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/85 (34%), Positives = 49/85 (57%) Frame = -3 Query: 257 FLSPELIHYQSRDAETLYYYYMLELPETFYGDTPGFNFVLALRHKHNFDEEFVPLNLNNN 78 + PEL+ S+ +E YY Y++EL + F + P NFVLA+R + D + L+L + Sbjct: 650 YFPPELVGQASQKSEAKYYCYLIELNQNFVYEIPVHNFVLAMRSELESDILGLDLDLEAD 709 Query: 77 GKELKISINYVGELTLNSEQVLICQ 3 L + + Y+GE+ L E V++C+ Sbjct: 710 RGLLMVKLKYIGEIHLTPETVIMCR 734 >gb|AFD22619.1| dicer-like 2 protein [Nicotiana attenuata] Length = 1403 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/85 (32%), Positives = 47/85 (55%) Frame = -3 Query: 257 FLSPELIHYQSRDAETLYYYYMLELPETFYGDTPGFNFVLALRHKHNFDEEFVPLNLNNN 78 + PEL+ + + D E +YY Y ++L Y +LA+R + FD+E + +L+ + Sbjct: 662 YFPPELVSHCANDTEAVYYCYEVDLQHDSYSSYQLCGIILAVRTRLKFDDERLTFDLDVD 721 Query: 77 GKELKISINYVGELTLNSEQVLICQ 3 L + +NY G + L SE+VL CQ Sbjct: 722 KGSLLVQVNYSGVVRLTSEEVLRCQ 746