BLASTX nr result
ID: Lithospermum22_contig00044810
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00044810 (220 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528600.1| conserved hypothetical protein [Ricinus comm... 54 1e-05 >ref|XP_002528600.1| conserved hypothetical protein [Ricinus communis] gi|223531996|gb|EEF33808.1| conserved hypothetical protein [Ricinus communis] Length = 524 Score = 54.3 bits (129), Expect = 1e-05 Identities = 32/79 (40%), Positives = 48/79 (60%), Gaps = 7/79 (8%) Frame = +3 Query: 3 LRRFEKLAELDPIELDKIMIERMEEDYKDKEPTS-------LGRDIDNPDTPMSTEILSR 161 LRRFE+LAELDP+EL+K M+E+ E+++ D+E L N D + E+L + Sbjct: 357 LRRFERLAELDPVELEKRMLEQ-EQEFDDEEEAEDDDDEIVLSDREQNIDNIIIEELLDK 415 Query: 162 ASFQQSRKFPTHLERLVLD 218 +F + RK P ++RLV D Sbjct: 416 PTFCRLRKIPKDMKRLVRD 434