BLASTX nr result
ID: Lithospermum22_contig00044635
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Lithospermum22_contig00044635 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002531481.1| ubiquitin-protein ligase, putative [Ricinus ... 73 3e-11 ref|XP_003554971.1| PREDICTED: uncharacterized protein LOC100815... 69 3e-10 ref|XP_004173036.1| PREDICTED: uncharacterized LOC101213123, par... 69 5e-10 ref|XP_002887108.1| zinc finger family protein [Arabidopsis lyra... 67 2e-09 ref|NP_176889.1| RING-finger and BRCT domain-containing protein ... 67 2e-09 >ref|XP_002531481.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223528908|gb|EEF30905.1| ubiquitin-protein ligase, putative [Ricinus communis] Length = 460 Score = 72.8 bits (177), Expect = 3e-11 Identities = 33/48 (68%), Positives = 40/48 (83%) Frame = +1 Query: 142 LQLPIRGMENVVATVTGYHGSDRFNLIKMIDRSGAKFVGYMNNSITHL 285 + LPI GME VVATV+GYHG++RFNLIK+I SGA +VG M+ SITHL Sbjct: 1 MDLPIEGMEKVVATVSGYHGTERFNLIKLISHSGASYVGAMSRSITHL 48 >ref|XP_003554971.1| PREDICTED: uncharacterized protein LOC100815034 [Glycine max] Length = 491 Score = 69.3 bits (168), Expect = 3e-10 Identities = 30/45 (66%), Positives = 39/45 (86%) Frame = +1 Query: 151 PIRGMENVVATVTGYHGSDRFNLIKMIDRSGAKFVGYMNNSITHL 285 P++GME VVATV+GYHGS+RFNLIK+I ++G +VG M+ SITHL Sbjct: 20 PVQGMERVVATVSGYHGSERFNLIKLISQAGGNYVGAMSKSITHL 64 >ref|XP_004173036.1| PREDICTED: uncharacterized LOC101213123, partial [Cucumis sativus] Length = 248 Score = 68.6 bits (166), Expect = 5e-10 Identities = 31/45 (68%), Positives = 38/45 (84%) Frame = +1 Query: 151 PIRGMENVVATVTGYHGSDRFNLIKMIDRSGAKFVGYMNNSITHL 285 PI GME+VV TV+GYHG++RFNLIKMI +GA +VG M+ SITHL Sbjct: 27 PIEGMESVVVTVSGYHGTERFNLIKMISYTGASYVGAMSRSITHL 71 >ref|XP_002887108.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] gi|297332949|gb|EFH63367.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata] Length = 464 Score = 66.6 bits (161), Expect = 2e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +1 Query: 163 MENVVATVTGYHGSDRFNLIKMIDRSGAKFVGYMNNSITHL 285 MENVVATV+GYHGSDRF LIK+I SGA +VG M+ SITHL Sbjct: 1 MENVVATVSGYHGSDRFKLIKLISHSGASYVGAMSRSITHL 41 >ref|NP_176889.1| RING-finger and BRCT domain-containing protein [Arabidopsis thaliana] gi|4204282|gb|AAD10663.1| Hypothetical protein [Arabidopsis thaliana] gi|332196488|gb|AEE34609.1| RING-finger and BRCT domain-containing protein [Arabidopsis thaliana] Length = 453 Score = 66.6 bits (161), Expect = 2e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +1 Query: 163 MENVVATVTGYHGSDRFNLIKMIDRSGAKFVGYMNNSITHL 285 MENVVATV+GYHGSDRF LIK+I SGA +VG M+ SITHL Sbjct: 1 MENVVATVSGYHGSDRFKLIKLISHSGASYVGAMSRSITHL 41